Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Scanning the structure and antigenicity of HPV-16 E6 and E7 oncoproteins using antipeptide antibodies.

    ID: 1844863

    Description: epitope description:KCLKFYSKISEYRHY antigen name:Protein E6 host organism:Oryctolagus cuniculus

    Publication: 7507231;

  2. Localization of epitopes recognized by monoclonal antibodies that neutralized the H3N2 influenza viruses in man.

    ID: 1844866

    Description: epitope description:G275, K276, N278 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:F008-039, F004-111, F004-144, F008-024, F008-...

    Publication: 21068214;

  3. Amino acid residues 56 to 69 of HLA-A2 specify an antigenic determinant shared by HLA-A2 and HLA-B17.

    ID: 1844873

    Description: epitope description:GPEYWDGETRKVKA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Oryctolagus cuniculus New Zealan...

    Publication: 2423602;

  4. Heavy-chain complementarity-determining regions determine conformation selectivity of anti-abeta antibodies.

    ID: 1844904

    Description: epitope description:DAEFGHDSGFEVRHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:mAb158, mAb1C3

    Publication: 20714111;

  5. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1844976

    Description: epitope description:EDIPQPPVSQFHIQGQVYCDTCRAGFITELSEFIP antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 21513971;

  6. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1844991

    Description: epitope description:GASLRLQCKDKENGDVTFTEVGYTRAEGLYS antigen name:Ole e 1 host organism:Oryctolagus cuniculus

    Publication: 21513971;

  7. Carrier-bound, nonallergenic Ole e 1 peptides for vaccination against olive pollen allergy.

    ID: 1845006

    Description: epitope description:MLVERDHKNEFCEITLISSGRKDCNEIPTEGWA antigen name:Ole e 1 host organism:Homo sapiens

    Publication: 21513971;

  8. Specific antibody responses to three schistosome-related carbohydrate structures in recently exposed immigrants and established residents in an area o...

    ID: 1845026

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-alpha-D-Galp antigen name:proteoglycan host organism:Homo sapien...

    Publication: 14500488;

  9. Amino acid residues 56 to 69 of HLA-A2 specify an antigenic determinant shared by HLA-A2 and HLA-B17.

    ID: 1845034

    Description: epitope description:GPEYWDGETRKVKA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Oryctolagus cuniculus New Zealan...

    Publication: 2423602;

  10. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845084

    Description: epitope description:KDYQRNRGPSKFTGLQPSVL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21669956;

  11. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845089

    Description: epitope description:YVPIVTFYSEISMHSSRAIP host organism:Capra hircus

    Publication: 21669956;

  12. Peptides specific for Mycobacterium avium subspecies paratuberculosis infection: diagnostic potential.

    ID: 1845090

    Description: epitope description:EARHVELCPDFKYYPFFCVP host organism:Capra hircus

    Publication: 21669956;

  13. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1845095

    Description: epitope description:GGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:mAb12

    Publication: 21451110;

  14. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845104

    Description: epitope description:alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp host organism:Oryctolagus cuniculus antibody name:anti-bee venom

    Publication: 21237664;

  15. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1845110

    Description: epitope description:EVDHTNFKYNYSVIEGGPIGDTLEKISNEIK antigen name:Bet v 1 host organism:Oryctolagus cuniculus

    Publication: 21451110;

  16. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845112

    Description: epitope description:alpha-D-Manp-(1->3)-[alpha-D-Manp-(1->6)]-[beta-D-Xylp-(1->2)]-beta-D-Manp host organism:Oryctolagus cuniculus antibody name:anti-...

    Publication: 21237664;

  17. Synthesis of cross-reactive carbohydrate determinants fragments as tools for in vitro allergy diagnosis.

    ID: 1845121

    Description: epitope description:beta-D-GlcpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-[alpha-L-Fucp-(1->6)]-beta-D-GlcpNAc host organism:Oryctolagus cuniculus antibody name...

    Publication: 21237664;

  18. A therapeutic antibody targeting BACE1 inhibits amyloid-beta production in vivo.

    ID: 1845943

    Description: epitope description:S314, E316, K317, F318, P319, Q327, L328, V329, C330, W331, Q332, A333, T335, P337, I340, T375, D378, C380 antigen name:Beta-secre...

    Publication: 21613622;

  19. A therapeutic antibody targeting BACE1 inhibits amyloid-beta production in vivo.

    ID: 1845947

    Description: epitope description:S314, E316, K317, F318, P319, Q327, L328, V329, C330, W331, Q332, A333, T335, P337, I340, T375, D378, C380 antigen name:Beta-secre...

    Publication: 21613622;

  20. Discrimination between the anti-monomeric and the anti-multimeric Lewis X response in murine schistosomiasis.

    ID: 1845948

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc-(1->4)-beta-D-Galp-(1->3)-D-Glcp antigen name:proteoglycan host organism:M...

    Publication: 15488731;

  21. Discrimination between the anti-monomeric and the anti-multimeric Lewis X response in murine schistosomiasis.

    ID: 1845958

    Description: epitope description:beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta...

    Publication: 15488731;

  22. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845965

    Description: epitope description:R224 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:H5-2A

    Publication: 21569761;

  23. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845968

    Description: epitope description:K250 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:H5-2A

    Publication: 21569761;

  24. Fine epitope mapping of monoclonal antibodies against hemagglutinin of a highly pathogenic H5N1 influenza virus using yeast surface display.

    ID: 1845975

    Description: epitope description:R178 antigen name:Hemagglutinin host organism:Mus musculus antibody name:NR2728

    Publication: 21569761;

  25. Bw4-reactive and Bw6-reactive antibodies recognize multiple distinct HLA structures that partially overlap in the alpha-1 helix.

    ID: 1845979

    Description: epitope description:L106, R107 antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus C57BL/6 HLA-B*1302 Tg ...

    Publication: 7523516;

  26. Structure of a core fragment of glycoprotein H from pseudorabies virus in complex with antibody.

    ID: 1845995

    Description: epitope description:V332, A333, P334, A335, Q337, P350, R351, D353, L354, R356, A357, T358, E361, A362, R365, K370, P371, F372, D373 antigen name:enve...

    Publication: 21149698;

  27. Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates.

    ID: 1846595

    Description: epitope description:C118, V119, L121, V196, T198, Q199, R406, K408, Q409, I410, M421, P424 antigen name:Envelope glycoprotein gp160 host organism:Homo...

    Publication: 11188697;

  28. Structure of a nanobody-stabilized active state of the beta(2) adrenoceptor.

    ID: 1846597

    Description: epitope description:T68, I127, R131, I135, T136, P138, F139, V222, A226, K267, E268, A271, T274, L275, I278, I325, Y326, R328, P330 antigen name:Beta-...

    Publication: 21228869;

  29. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846609

    Description: epitope description:AAIHSVVHSI antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  30. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846614

    Description: epitope description:AQGSVQPQQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  31. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846617

    Description: epitope description:ARELNPSNKE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  32. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846623

    Description: epitope description:CCQQLAQIPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  33. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846626

    Description: epitope description:CNVYVPPECS antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  34. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846628

    Description: epitope description:CQAIHNVAHA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  35. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846631

    Description: epitope description:CQQLLQIPEQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  36. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846633

    Description: epitope description:CSIMRAPFAS antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  37. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846637

    Description: epitope description:DIFLPLSQHE antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  38. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846653

    Description: epitope description:FAQPQQLFPE antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  39. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846656

    Description: epitope description:FIQPSLQQQL antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  40. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846661

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  41. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846662

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  42. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846663

    Description: epitope description:FPLQPQQPFP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  43. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846666

    Description: epitope description:FPPQQPYPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;

  44. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846667

    Description: epitope description:FPPQQPYPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;

  45. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846671

    Description: epitope description:FPQLQQPQQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  46. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846680

    Description: epitope description:FPQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  47. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846686

    Description: epitope description:FPQQPQQPFP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  48. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846697

    Description: epitope description:FPQQPYPQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  49. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846698

    Description: epitope description:FPQQQFPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  50. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846700

    Description: epitope description:FPQQSEQIIP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston