Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. An exposed domain in the severe acute respiratory syndrome coronavirus spike protein induces neutralizing antibodies.

    ID: 1850697

    Description: epitope description:STAIHADQLTPAWRIYSTGNN antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S78, S26

    Publication: 15194798;

  2. An exposed domain in the severe acute respiratory syndrome coronavirus spike protein induces neutralizing antibodies.

    ID: 1850701

    Description: epitope description:FQQFGRDVSDFTDSVRDPKT antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:S34, S84

    Publication: 15194798;

  3. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850707

    Description: epitope description:TATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKA antigen name:Spike glycoprotein host organism:Homo sapiens

    Publication: 15194770;

  4. Synthesis of the carbohydrate moiety from the parasite Echinococcus multilocularis and their antigenicity against human sera.

    ID: 1850714

    Description: epitope description:alpha-D-Galp-(1->4)-beta-D-Galp-(1->3)-[beta-D-GlcpNAc-(1->6)]-alpha-D-GalpNAc antigen name:O-glycoprotein host organism:Homo sapi...

    Publication: 21402433;

  5. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850726

    Description: epitope description:RSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15194770;

  6. Identification of an antigenic determinant on the S2 domain of the severe acute respiratory syndrome coronavirus spike glycoprotein capable of inducin...

    ID: 1850727

    Description: epitope description:RSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLP antigen name:Spike glycoprotein host organism:Mus musculus BALB/c

    Publication: 15194770;

  7. Identification of conformational neutralizing epitopes on the capsid protein of canine calicivirus.

    ID: 1850732

    Description: epitope description:G517 antigen name:capsid protein precursor host organism:Mus musculus BALB/c antibody name:27G2

    Publication: 11413381;

  8. Identification of protective epitopes on ebola virus glycoprotein at the single amino acid level by using recombinant vesicular stomatitis viruses.

    ID: 1850861

    Description: epitope description:H549 antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:133/3.16

    Publication: 12502822;

  9. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850903

    Description: epitope description:tartrazine host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  10. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850949

    Description: epitope description:4-aminobenzenesulfonic acid host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  11. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850951

    Description: epitope description:4-aminobenzenesulfonic acid host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  12. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850955

    Description: epitope description:1-(4-sulfophenyl)-3-carboxy-4-amino-5-oxopyrazole host organism:Cavia porcellus Duncan-Hartley

    Publication: 2409032;

  13. Immunological studies on tartrazine and its metabolites. I. Animal studies.

    ID: 1850960

    Description: epitope description:1-(4-sulfophenyl)-3-carboxy-4-amino-5-oxopyrazole host organism:Rattus norvegicus Wistar

    Publication: 2409032;

  14. Identification of protective epitopes on ebola virus glycoprotein at the single amino acid level by using recombinant vesicular stomatitis viruses.

    ID: 1850975

    Description: epitope description:R134, F194, L199 antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:226/8.1

    Publication: 12502822;

  15. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850979

    Description: epitope description:VRVPVPQLQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  16. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850980

    Description: epitope description:VPVPQLQLQN antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  17. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1850993

    Description: epitope description:YPQPQPFPSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  18. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851012

    Description: epitope description:PQQPYPQPQP antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  19. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851014

    Description: epitope description:YPQPQPQYSQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  20. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851022

    Description: epitope description:QQQQQILQQI antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  21. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851024

    Description: epitope description:LQQQLIPCRD antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  22. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851026

    Description: epitope description:VVLQQHNIAH antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  23. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851035

    Description: epitope description:QQHHHHQEQK antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  24. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851048

    Description: epitope description:QQQQQPLSQV antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  25. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851052

    Description: epitope description:QVSFQQPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  26. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851054

    Description: epitope description:QQPQQQYPSG antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 21366336;

  27. Similarity of fine specificity of IgA anti-gliadin antibodies between patients with celiac disease and humanized alpha1KI mice.

    ID: 1851056

    Description: epitope description:QQYPSGQGFF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 21366336;

  28. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846871

    Description: epitope description:PLQPQQPFPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  29. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846873

    Description: epitope description:PLSQHEQVGQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  30. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846875

    Description: epitope description:PLVQQQQFPG antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  31. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846880

    Description: epitope description:PQFAEIRNLA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  32. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846881

    Description: epitope description:PQFAEIRNLA antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  33. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846884

    Description: epitope description:PQLPYPQPQS antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  34. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846893

    Description: epitope description:PQPQQPQQPF antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  35. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846901

    Description: epitope description:PQQPFPLQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  36. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846903

    Description: epitope description:PQQPFPQLQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  37. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846907

    Description: epitope description:PQQPFPQPQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  38. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846915

    Description: epitope description:PQQPFPQQPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  39. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846921

    Description: epitope description:PQQPFPQQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  40. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846925

    Description: epitope description:PQQPFPQTQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  41. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846929

    Description: epitope description:PQQPFPQTQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  42. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846930

    Description: epitope description:PQQPFPWQPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  43. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846935

    Description: epitope description:PQQPQQPFLQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  44. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846938

    Description: epitope description:PQQPQQPFPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  45. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846941

    Description: epitope description:PQQPQQSFPQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  46. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846947

    Description: epitope description:PQQPYPQQQP antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  47. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846952

    Description: epitope description:PQQQRPFIQP antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  48. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846962

    Description: epitope description:PQQTFPQPQQ antigen name:Uncharacterized protein (UniProt:D2KFG9) host organism:Homo sapiens

    Publication: 15876313;

  49. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846965

    Description: epitope description:PRPQQSPEQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 15876313;

  50. Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat.

    ID: 1846966

    Description: epitope description:PSQQQPQEQV antigen name:Tri a 21 host organism:Homo sapiens

    Publication: 15876313;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston