Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507839

    Description: epitope description:D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-12G2

    Publication: 1714939;

  2. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507872

    Description: epitope description:TYEAALKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  3. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507888

    Description: epitope description:TYEAALKQYEA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  4. Protective immune response to foot-and-mouth disease virus with VP1 expressed in transgenic plants.

    ID: 1507920

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 9445079;

  5. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507959

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 2154148;

  6. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507968

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:3

    Publication: 1656083;

  7. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507971

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  8. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507972

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  9. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507973

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 2154148;

  10. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507985

    Description: epitope description:S147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1

    Publication: 1656083;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston