Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508259

    Description: epitope description:ANDCISRPDTKTEFVTKIQAATTESQLNEIKRSIIRSAI antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:2-1A, 5A...

    Publication: 9191922;

  2. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508404

    Description: epitope description:STNPKPQRKTKRNTNRRPQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  3. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508409

    Description: epitope description:PRGSRPSWGPTDPRRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  4. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508413

    Description: epitope description:LPGCSFSIFLLALLSCLTIPASA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  5. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508429

    Description: epitope description:SRGNHVSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  6. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508434

    Description: epitope description:KLYVCLNE antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  7. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508436

    Description: epitope description:TATKQAEAAAPVVESKWRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  8. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508437

    Description: epitope description:KSKKCPMGFSYDTRCFDSTVTENDIRTEES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  9. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508441

    Description: epitope description:VKFPGGGQIVGGVYLLPRRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  10. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508442

    Description: epitope description:RKTSERSQPRGRRQPIPKARRPEGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston