Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500096

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Rattus norvegicus Fischer 344

    Publication: 8423348;

  2. Synthetic peptides deduced from the amino acid sequence of Epstein-Barr virus nuclear antigen 6 (EBNA 6): antigenic properties, production of monoreac...

    ID: 1500097

    Description: epitope description:PAPQAPYQGYQEPPAPQAPY antigen name:Epstein-Barr nuclear antigen 6 host organism:Oryctolagus cuniculus antibody name:rabbit anti-p-6...

    Publication: 7595412;

  3. An influenza A vaccine based on tetrameric ectodomain of matrix protein 2.

    ID: 1500098

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSS antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 18252707;

  4. Schistosoma mansoni 28-kDa glutathione S-transferase and immunity against parasite fecundity and egg viability. Role of the amino- and carboxyl-termin...

    ID: 1500103

    Description: epitope description:ENLLASSPRLAKYLSNRPATPF antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/c

    Publication: 8423348;

  5. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1500105

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  6. Non-immunized natural human heavy chain CDR3 repertoires allow the isolation of high affinity peptides mimicking a human influenza hemagglutinin epito...

    ID: 1500106

    Description: epitope description:YPYDVPDYA antigen name:Hemagglutinin host organism:Mus musculus antibody name:17/9

    Publication: 17936360;

  7. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500112

    Description: epitope description:KYLGFVQDAA antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  8. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500114

    Description: epitope description:LQPGVDIIEG antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  9. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500123

    Description: epitope description:YYIPLEAVKF antigen name:Hev b 3 host organism:Homo sapiens

    Publication: 11275264;

  10. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500127

    Description: epitope description:AVITWRALNK antigen name:Hev b 3 host organism:Homo sapiens

    Publication: 11275264;

  11. Unique and shared IgE epitopes of Hev b 1 and Hev b 3 in latex allergy.

    ID: 1500153

    Description: epitope description:LQPGVDIIEG antigen name:Hev b 1 host organism:Homo sapiens

    Publication: 11275264;

  12. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500155

    Description: epitope description:NKVSARGCTF antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  13. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500156

    Description: epitope description:RGCTFYGCWK antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  14. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500158

    Description: epitope description:GLVGRPKSKL antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  15. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500159

    Description: epitope description:PKSKLSVKKC antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  16. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500160

    Description: epitope description:SVKKCLFEKC antigen name:E1B 55 kDa protein host organism:Homo sapiens

    Publication: 7694817;

  17. Antibodies to E1b protein-derived peptides of enteric adenovirus type 40 are associated with celiac disease and dermatitis herpetiformis.

    ID: 1500171

    Description: epitope description:GRVSARGCTFVACWKGVVG antigen name:control protein E1B 55K host organism:Homo sapiens

    Publication: 7694817;

  18. Protection of swine from foot-and-mouth disease with one dose of an all-D retro peptide.

    ID: 1500183

    Description: epitope description:GSGVRGDFGSLAPRVARQL + D-aa(G1,S2,G3,V4,R5,G6,D7,F8,G9,S10,L11,A12,P13,R14,V15,A16,R17,Q18,L19) antigen name:Genome polyprotein hos...

    Publication: 10438060;

  19. Analysis and simulation of a neutralizing epitope of transmissible gastroenteritis virus.

    ID: 1500187

    Description: epitope description:NNSNDL antigen name:Spike glycoprotein host organism:Mus musculus antibody name:MAb 57.57

    Publication: 1693702;

  20. A single amino acid substitution in the S1 and S2 Spike protein domains determines the neutralization escape phenotype of SARS-CoV.

    ID: 1500212

    Description: epitope description:V601, D757 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:SKOT3

    Publication: 18606245;

  21. A single amino acid substitution in the S1 and S2 Spike protein domains determines the neutralization escape phenotype of SARS-CoV.

    ID: 1500226

    Description: epitope description:Y442, A834 antigen name:Spike glycoprotein host organism:Mus musculus antibody name:SKOT20

    Publication: 18606245;

  22. Mimicry of a neutralizing epitope of the major outer membrane protein of Chlamydia trachomatis by anti-idiotypic antibodies.

    ID: 1500232

    Description: epitope description:SDVEGLQNDP host organism:Mus musculus BALB/c antibody name:11A12; 2D7

    Publication: 7507888;

  23. Mutants of the major ryegrass pollen allergen, Lol p 5, with reduced IgE-binding capacity: candidates for grass pollen-specific immunotherapy.

    ID: 1500263

    Description: epitope description:K197, F198, T199, V200 antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 11782018;

  24. Mimicry of a neutralizing epitope of the major outer membrane protein of Chlamydia trachomatis by anti-idiotypic antibodies.

    ID: 1500319

    Description: epitope description:LDVTTLNPTI host organism:Mus musculus BALB/c

    Publication: 7507888;

  25. Monoclonal antibodies raised against the ORF3 protein of hepatitis E virus (HEV) can capture HEV particles in culture supernatant and serum but not th...

    ID: 1500324

    Description: epitope description:LGATSPSAPPLPPVVDLPQLGLRR antigen name:Protein ORF3 host organism:Mus musculus BALB/c antibody name:TA0503, TA0512, TA0523, TA0531,...

    Publication: 18679765;

  26. High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

    ID: 1500328

    Description: epitope description:KMGEEFTPDWMMESDFQGW host organism:Mus musculus BALB/c antibody name:mAb 2H1

    Publication: 12471134;

  27. High affinity mimotope of the polysaccharide capsule of Cryptococcus neoformans identified from an evolutionary phage peptide library.

    ID: 1500329

    Description: epitope description:FGGETFTPDWMMEVAIDNE host organism:Mus musculus BALB/c antibody name:mAb 2H1

    Publication: 12471134;

  28. Mutants of the major ryegrass pollen allergen, Lol p 5, with reduced IgE-binding capacity: candidates for grass pollen-specific immunotherapy.

    ID: 1500388

    Description: epitope description:K82, K197, F198, T199, V200, G298, K300 antigen name:Other Lolium perenne (perennial ryegrass) protein host organism:Homo sapiens

    Publication: 11782018;

  29. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500393

    Description: epitope description:LTILVALALFLLAAH antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  30. Epitope mapping of allergen ovalbumin using biofunctionalized magnetic beads packed in microfluidic channels The first step towards epitope-based vacc...

    ID: 1500396

    Description: epitope description:HIATNAVLFFGR antigen name:Gal d 2 host organism:Oryctolagus cuniculus

    Publication: 18707690;

  31. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500405

    Description: epitope description:LALFLLAAHASARQQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  32. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500413

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  33. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500414

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  34. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500415

    Description: epitope description:AAHASARQQWELQGD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  35. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500417

    Description: epitope description:HASARQQWELQGDRR antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  36. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500424

    Description: epitope description:RQQWELQGDRRCQSQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  37. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500426

    Description: epitope description:QWELQGDRRCQSQLE antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  38. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500428

    Description: epitope description:QWELQGDRRCQSQLE antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  39. Monoclonal antibody-defined epitope map of expressed rubella virus protein domains.

    ID: 1507826

    Description: epitope description:MEDLQKALEAQSRALRAGLAA antigen name:Structural polyprotein host organism:Mus musculus BALB/c antibody name:C1, C2, C8

    Publication: 1712855;

  40. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507830

    Description: epitope description:G96, D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-10C8

    Publication: 1714939;

  41. Analysis of the neutralization epitopes on human rotavirus VP7 recognized by monotype-specific monoclonal antibodies.

    ID: 1507839

    Description: epitope description:D97 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-12G2

    Publication: 1714939;

  42. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507872

    Description: epitope description:TYEAALKQYEADLAA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  43. Immunogenicity of peptides coupled with multiple T-cell epitopes of a surface protein antigen of Streptococcus mutans.

    ID: 1507888

    Description: epitope description:TYEAALKQYEA antigen name:UniProt:I6TX52 host organism:Mus musculus B10.M

    Publication: 8690461;

  44. Protective immune response to foot-and-mouth disease virus with VP1 expressed in transgenic plants.

    ID: 1507920

    Description: epitope description:RYSRNAVPNVRGDLQVLAQKVARTLP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 9445079;

  45. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507959

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Bos taurus

    Publication: 2154148;

  46. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507968

    Description: epitope description:N94 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:3

    Publication: 1656083;

  47. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507971

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  48. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507972

    Description: epitope description:N147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1, RV-4:5

    Publication: 1656083;

  49. Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines.

    ID: 1507973

    Description: epitope description:SASGSGVRGDFGSLAPRVARQLPASFNYGAIK antigen name:Genome polyprotein host organism:Sus scrofa Yorkshire

    Publication: 2154148;

  50. Relation of VP7 amino acid sequence to monoclonal antibody neutralization of rotavirus and rotavirus monotype.

    ID: 1507985

    Description: epitope description:S147, L148 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:RV-4:1

    Publication: 1656083;

  51. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508075

    Description: epitope description:PPYVEPTAPQVL antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1537894;

  52. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508082

    Description: epitope description:GDYSPSCCTLTIGVSSYHSKPCNPAQPVCS antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  53. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508083

    Description: epitope description:TKKPNRNGGGYYSASYSDPGSLKCPVY antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  54. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508088

    Description: epitope description:LVQLTLQSTNYTCIVCIDRASLST antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  55. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508090

    Description: epitope description:STWHVLYSPNVSVPSSSSTP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  56. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508102

    Description: epitope description:LDLLFWEQGGLCKALQEQCRFP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  57. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508105

    Description: epitope description:GWGLNWDLGLSQWAREALQTGIT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  58. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1508107

    Description: epitope description:LAGPCILRQLRHLPSRVRYPHYSLIKPESSL antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  59. Two different 8 kDa monomers are involved in the oligomeric organization of the native Echinococcus granulosus antigen B.

    ID: 1508114

    Description: epitope description:LKMFGEVKYFFERDPLGQKVVDLLKEL antigen name:AntigenB host organism:Mus musculus antibody name:AB10, BG10, DC11, EB7, EG9 and CB5

    Publication: 9226697;

  60. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508116

    Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  61. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508119

    Description: epitope description:ATLVVNRIRGGF antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  62. Serological responses of patients with ectopic pregnancy to epitopes of the Chlamydia trachomatis 60 kDa heat shock protein.

    ID: 1508121

    Description: epitope description:ILPGGGTALIRC antigen name:60 kDa chaperonin host organism:Homo sapiens

    Publication: 9619577;

  63. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508135

    Description: epitope description:PSFPTQRTSKTLKVLTPPIT antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  64. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508148

    Description: epitope description:LQSSSFIFHKFQTKAYHPSF antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  65. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508149

    Description: epitope description:YHPSFLLSHGLIQYSSFHSL antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  66. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508161

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  67. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508168

    Description: epitope description:DSWDHEQA antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR76

    Publication: 7519806;

  68. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508170

    Description: epitope description:SLVGDKLY antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  69. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508173

    Description: epitope description:AEIRGERK antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR69

    Publication: 7519806;

  70. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508176

    Description: epitope description:MAEEPTYTTEQVDELIHAGLGTVDFFLSRPIDAQSSLGKGSIPPGVT antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:...

    Publication: 9191922;

  71. Analysis of the newly identified neutralization epitopes on VP7 of human rotavirus serotype 1.

    ID: 1508179

    Description: epitope description:Q104, D145, M217 antigen name:Outer capsid glycoprotein VP7 host organism:Mus musculus BALB/c antibody name:K8-3C10

    Publication: 1703558;

  72. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508193

    Description: epitope description:SRSLPRQSLIQPPTFHPPSS antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  73. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508195

    Description: epitope description:MDTWNPPLGSTSQPCLFQTP antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  74. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508212

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  75. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508214

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  76. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508215

    Description: epitope description:TKDTNNNLCG + D-aa(C9) host organism:Mus musculus BALB/c

    Publication: 12729743;

  77. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508224

    Description: epitope description:SPGGLEPPSEKHFRETEV antigen name:Protein Tax-1 host organism:Homo sapiens

    Publication: 8158021;

  78. Immunogenicity of peptide-vaccine candidates predicted by molecular dynamics simulations.

    ID: 1508233

    Description: epitope description:TKDTNNNLCGN host organism:Mus musculus BALB/c

    Publication: 12729743;

  79. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508242

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  80. Differential immune responsiveness to the immunodominant epitopes of regulatory proteins (tax and rex) in human T cell lymphotropic virus type I-assoc...

    ID: 1508243

    Description: epitope description:TGAPSLGDYVRPAYIVTPYW antigen name:Protein Rex host organism:Homo sapiens

    Publication: 8158021;

  81. Human parainfluenza virus type 2 phosphoprotein: mapping of monoclonal antibody epitopes and location of the multimerization domain.

    ID: 1508259

    Description: epitope description:ANDCISRPDTKTEFVTKIQAATTESQLNEIKRSIIRSAI antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibody name:2-1A, 5A...

    Publication: 9191922;

  82. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508404

    Description: epitope description:STNPKPQRKTKRNTNRRPQD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  83. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508409

    Description: epitope description:PRGSRPSWGPTDPRRR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  84. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508413

    Description: epitope description:LPGCSFSIFLLALLSCLTIPASA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  85. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508429

    Description: epitope description:SRGNHVSPTHYVPESDAAAR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  86. Antigenic structure of the coat protein of potato mop-top furovirus.

    ID: 1508434

    Description: epitope description:KLYVCLNE antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:SCR77

    Publication: 7519806;

  87. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508436

    Description: epitope description:TATKQAEAAAPVVESKWRA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  88. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508437

    Description: epitope description:KSKKCPMGFSYDTRCFDSTVTENDIRTEES antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  89. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508441

    Description: epitope description:VKFPGGGQIVGGVYLLPRRG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  90. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508442

    Description: epitope description:RKTSERSQPRGRRQPIPKARRPEGR antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  91. Identification of immunodominant epitopes in the core and non-structural region of hepatitis C virus by enzyme immunoassay using synthetic peptides.

    ID: 1508448

    Description: epitope description:PPALPIWARPDYNPPLLESWKDPD antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7543117;

  92. Localization of antigenic domains on the major subunits of Bordetella pertussis serotype 2 and 3 fimbriae.

    ID: 1508470

    Description: epitope description:KVTNGSKSYTLRYLASYVK antigen name:Serotype 3 fimbrial subunit host organism:Mus musculus Porton

    Publication: 7512870;

  93. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508477

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  94. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508486

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  95. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508487

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  96. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508491

    Description: epitope description:QYPALTA antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:D11, F10

    Publication: 7505073;

  97. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508500

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  98. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508501

    Description: epitope description:QPMGPQPMGPQPMEP antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  99. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508509

    Description: epitope description:FGMLPVPQQPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  100. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508510

    Description: epitope description:QPMEPQPLPMGPQ antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston