Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929091

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  2. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929093

    Description: epitope description:RYKYYPETPQGLAKII antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  3. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929095

    Description: epitope description:GLAKIIQKAHKEGVCG antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  4. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929100

    Description: epitope description:SRLEHQMWEAVKDELN antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  5. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929106

    Description: epitope description:ENGVDLSVVVEKQEGM antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  6. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929110

    Description: epitope description:EKQEGMYKSAPKRLTA antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  7. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929111

    Description: epitope description:EKQEGMYKSAPKRLTA antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  8. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929113

    Description: epitope description:PKRLTATTEKLEIGWK antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  9. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929121

    Description: epitope description:NTFVVDGPETKECPTQ antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  10. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929122

    Description: epitope description:NTFVVDGPETKECPTQ antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  11. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929128

    Description: epitope description:KECPTQNRAWNSLEVE antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  12. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929135

    Description: epitope description:GLTSTRMFLKVRESNT antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  13. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929141

    Description: epitope description:SKIIGTAVKNNLAIHS antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  14. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929153

    Description: epitope description:KSCTWPETHTLWGDGI antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  15. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929157

    Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  16. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929158

    Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Aves

    Publication: 22347477;

  17. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929159

    Description: epitope description:LWGDGILESDLIIPVT antigen name:Genome polyprotein host organism:Aves

    Publication: 22347477;

  18. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929177

    Description: epitope description:CGHRGPATRTTTESGK antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  19. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929183

    Description: epitope description:WCCRSCTLPPLRYQTD antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  20. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929193

    Description: epitope description:DEKTLVQSQVNA antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  21. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929198

    Description: epitope description:VHNDVEAWVDRYKYLP antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  22. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929203

    Description: epitope description:IHNDVEAWIDRYKYLP antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  23. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929208

    Description: epitope description:NTFVIDGPETKECPTQ antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  24. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929209

    Description: epitope description:NTFVIDGPETKECPTQ antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  25. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929213

    Description: epitope description:STFVVDGPETAECPNS antigen name:Genome polyprotein host organism:Gallus gallus

    Publication: 22347477;

  26. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929221

    Description: epitope description:LWGDGVLESDLIIPIT antigen name:Genome polyprotein host organism:Anser sp.

    Publication: 22347477;

  27. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929223

    Description: epitope description:LWGDGVEESELIIPHT antigen name:Genome polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  28. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929228

    Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Gallus gallus

    Publication: 22347477;

  29. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929229

    Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Anas platyrhynchos

    Publication: 22347477;

  30. Comprehensive mapping of common immunodominant epitopes in the West Nile virus nonstructural protein 1 recognized by avian antibody responses.

    ID: 1929230

    Description: epitope description:LWGDGVVESEMIIPVT antigen name:polyprotein host organism:Anser sp.

    Publication: 22347477;

  31. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929232

    Description: epitope description:PALDAAETGHTSSVQPEDMIETRYVITDQTRDET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22121050;

  32. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929234

    Description: epitope description:NPVENYIDSVLNEVLVVPNIQ antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22121050;

  33. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929237

    Description: epitope description:QPEDMIETRYVITDQTRDET antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22121050;

  34. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929239

    Description: epitope description:CIAMIEFNTSSDKTEHDKIG antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22121050;

  35. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929293

    Description: epitope description:VVPNIQPSTSVSSHAAPALD antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 22121050;

  36. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929299

    Description: epitope description:TRDETSIESFLGRSGCIAMI antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 22121050;

  37. Misdirected antibody responses against an N-terminal epitope on human rhinovirus VP1 as explanation for recurrent RV infections.

    ID: 1929301

    Description: epitope description:CIAMIEFNTSSDKTEHDKIG antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 22121050;

  38. Synthesis-based approach toward direct sandwich immunoassay for ciguatoxin CTX3C.

    ID: 1929339

    Description: epitope description:(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol anti...

    Publication: 12812503;

  39. Synthesis-based approach toward direct sandwich immunoassay for ciguatoxin CTX3C.

    ID: 1929341

    Description: epitope description:(4Z)-2,8:7,12:11,15:14,18:17,22-pentaanhydro-4,5,6,9,10,13,19,20,21-nonadeoxy-L-arabino-L-allo-L-allo-docosa-4,9,20-trienitol anti...

    Publication: 12812503;

  40. Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

    ID: 1929346

    Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

    Publication: 22160315;

  41. Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

    ID: 1929348

    Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

    Publication: 22160315;

  42. Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

    ID: 1929354

    Description: epitope description:LYEGQFHS antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:15B5

    Publication: 22160315;

  43. Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

    ID: 1929359

    Description: epitope description:PSNEFE antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:13G10, 10G4

    Publication: 22160315;

  44. Development of monoclonal antibodies to recombinant terrelysin and characterization of expression in Aspergillus terreus.

    ID: 1929361

    Description: epitope description:LYEGQFHS antigen name:Terrelysin host organism:Mus musculus BALB/c antibody name:15B5

    Publication: 22160315;

  45. A cross-protective mAb recognizes a novel epitope within the flavivirus NS1 protein.

    ID: 1929383

    Description: epitope description:KAWGKSILFA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:16NS1

    Publication: 21918007;

  46. A highly alpha-stereoselective synthesis of oligosaccharide fragments of the Vi antigen from Salmonella typhi and their antigenic activities.

    ID: 1929395

    Description: epitope description:3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc antigen name:[4)-3-O-Ac-alpha-D-GalpANAc(1->]n host organism:Oryctolagus cu...

    Publication: 22095754;

  47. A highly alpha-stereoselective synthesis of oligosaccharide fragments of the Vi antigen from Salmonella typhi and their antigenic activities.

    ID: 1929396

    Description: epitope description:3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc-(1->4)-3-O-Ac-alpha-D-GalpANAc antigen name:[4)-3-O-Ac-alpha-D-GalpANAc(1->...

    Publication: 22095754;

  48. Helicobacter pylori isolates from Greek children express type 2 and type 1 Lewis and alpha1,6-glucan antigens in conjunction with a functional type IV...

    ID: 1929400

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musculus antibody name:P...

    Publication: 22160312;

  49. Genetic mapping of a highly variable norovirus GII.4 blockade epitope: potential role in escape from human herd immunity.

    ID: 1929502

    Description: epitope description:V294, S296, H297, D298, T368, N372 antigen name:Capsid protein VP1 host organism:Homo sapiens

    Publication: 22090110;

  50. Bacterial Toxin Fusion Proteins Elicit Mucosal Immunity against a Foot-and-Mouth Disease Virus Antigen When Administered Intranasally to Guinea Pigs.

    ID: 1929717

    Description: epitope description:RYSRNAVPNLRGDLQVLAQKVART antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley

    Publication: 22312350;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston