Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937696

    Description: epitope description:MSDRGIF host organism:Homo sapiens

    Publication: 22555070;

  2. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937698

    Description: epitope description:SPIISHY host organism:Homo sapiens

    Publication: 22555070;

  3. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937699

    Description: epitope description:SPILAHY host organism:Homo sapiens

    Publication: 22555070;

  4. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937700

    Description: epitope description:SPITLYY host organism:Homo sapiens

    Publication: 22555070;

  5. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937701

    Description: epitope description:VPPRGLF host organism:Homo sapiens

    Publication: 22555070;

  6. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937705

    Description: epitope description:LPPRGLF host organism:Homo sapiens

    Publication: 22555070;

  7. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937712

    Description: epitope description:FSPIIAF host organism:Homo sapiens

    Publication: 22555070;

  8. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937722

    Description: epitope description:EWSRGIF host organism:Homo sapiens

    Publication: 22555070;

  9. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937742

    Description: epitope description:VLPGSKS host organism:Homo sapiens

    Publication: 22555070;

  10. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937745

    Description: epitope description:ACCRSIP host organism:Homo sapiens

    Publication: 22555070;

  11. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937746

    Description: epitope description:AVESNDK host organism:Homo sapiens

    Publication: 22555070;

  12. IgE epitopes of intact and digested Ara h 1: a comparative study in humans and rats.

    ID: 1937751

    Description: epitope description:TPFSNSP host organism:Homo sapiens

    Publication: 22555070;

  13. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938204

    Description: epitope description:GFLSELTQQLAQATGKPP antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  14. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938210

    Description: epitope description:QLMAFGGSSE antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxH08

    Publication: 22238348;

  15. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938223

    Description: epitope description:NYYDMNAANVGWNNSTFA antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxF07

    Publication: 22238348;

  16. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938235

    Description: epitope description:NYYDMNAANVGWNNSTFA antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxF07

    Publication: 22238348;

  17. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938238

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxD08

    Publication: 22238348;

  18. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938240

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxD08

    Publication: 22238348;

  19. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938247

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens antibody name:BaxG03

    Publication: 22238348;

  20. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938250

    Description: epitope description:FGGSSEPCALCSLHSIGKI antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  21. Neutralization of macrophage migration inhibitory factor (MIF) by fully human antibodies correlates with their specificity for the beta-sheet structur...

    ID: 1938255

    Description: epitope description:ERLRISPDRVYINYYDMN antigen name:Macrophage migration inhibitory factor host organism:Homo sapiens

    Publication: 22238348;

  22. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938307

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  23. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938308

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  24. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938316

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:6F12

    Publication: 22491456;

  25. A pan-H1 anti-hemagglutinin monoclonal antibody with potent broad-spectrum efficacy in vivo.

    ID: 1938320

    Description: epitope description:A388 antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 22491456;

  26. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1938844

    Description: epitope description:VRNVDLLPEQTKKEDDP antigen name:Genome polyprotein host organism:Equus caballus

    Publication: 21930350;

  27. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1938853

    Description: epitope description:LLVVMVPEYVAEQQRDFRGSWQDKDSDGLPGEWKWQSYDALPRHLPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  28. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938873

    Description: epitope description:A54, T55, L56, R57, V129, Q131, P132, E133, N134, P166, K246, K247 antigen name:Genome polyprotein host organism:Homo sapiens anti...

    Publication: 22509258;

  29. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938888

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  30. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938896

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  31. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938898

    Description: epitope description:P54, L56, Q58, N59, P61, W67 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:D29

    Publication: 22509258;

  32. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938916

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  33. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938918

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  34. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938928

    Description: epitope description:PGFTVMAAIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:2H2

    Publication: 22509258;

  35. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938930

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  36. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938933

    Description: epitope description:GRLTTVNPIVT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:4G2

    Publication: 22509258;

  37. A human PrM antibody that recognizes a novel cryptic epitope on dengue E glycoprotein.

    ID: 1938946

    Description: epitope description:K305, P384 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3H5

    Publication: 22509258;

  38. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939066

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  39. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939070

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  40. Anaphylaxis to pork kidney is related to IgE antibodies specific for galactose-alpha-1,3-galactose.

    ID: 1939076

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose antigen name:glycoprotein host organism:Mus musculus antibody name:M86

    Publication: 22494361;

  41. Antibodies directed to drug epitopes to investigate the structure of drug-protein photoadducts. Recognition of a common photobound substructure in tia...

    ID: 1939077

    Description: epitope description:tiaprofenic acid host organism:Oryctolagus cuniculus

    Publication: 11712905;

  42. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1939094

    Description: epitope description:VRNVELGPEKKDKKDDP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  43. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939095

    Description: epitope description:EQDRKPRN antigen name:Envelope glycoprotein B host organism:Mus musculus

    Publication: 22649465;

  44. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939104

    Description: epitope description:GRTDRPSA antigen name:Envelope glycoprotein C host organism:Mus musculus

    Publication: 22649465;

  45. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939108

    Description: epitope description:GRTDRPSA antigen name:Envelope glycoprotein C host organism:Mus musculus

    Publication: 22649465;

  46. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939114

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  47. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939115

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  48. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939119

    Description: epitope description:DPPERPDSP antigen name:Envelope glycoprotein E host organism:Mus musculus

    Publication: 22649465;

  49. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939122

    Description: epitope description:EPPDDDDS antigen name:Envelope glycoprotein G host organism:Mus musculus

    Publication: 22649465;

  50. Prediction and identification of potential immunodominant epitopes in glycoproteins B, C, E, G, and I of herpes simplex virus type 2.

    ID: 1939123

    Description: epitope description:EPPDDDDS antigen name:Envelope glycoprotein G host organism:Mus musculus

    Publication: 22649465;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston