Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911007

    Description: epitope description:W101, F108 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-12, FL0232

    Publication: 22235356;

  2. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911011

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  3. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911012

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  4. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911013

    Description: epitope description:Q211, D215, P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DENV4-4

    Publication: 22235356;

  5. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911018

    Description: epitope description:K307, K310, L389 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:FL0251

    Publication: 22235356;

  6. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911024

    Description: epitope description:P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN3-3

    Publication: 22235356;

  7. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911033

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:FL0231

    Publication: 22235356;

  8. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911037

    Description: epitope description:W101, G106, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:4G2

    Publication: 22235356;

  9. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911040

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  10. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911041

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  11. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911042

    Description: epitope description:P217, T265 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN2-9

    Publication: 22235356;

  12. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911043

    Description: epitope description:P217 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:DEN3-3

    Publication: 22235356;

  13. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911062

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Mus musculus antibody name:FL0231

    Publication: 22235356;

  14. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911069

    Description: epitope description:W101, L107 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  15. Glycoproteins are species-specific markers and major IgE reactants in grass pollens.

    ID: 1911085

    Description: epitope description:beta-D-Galp-(1->3)-[alpha-L-Fucp-(1->4)]-D-GlcpNAc antigen name:Laccase host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21951299;

  16. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911093

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  17. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911095

    Description: epitope description:W101, F108, V122, T293 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  18. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911096

    Description: epitope description:W101, L107, F108 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  19. Analysis of epitopes on dengue virus envelope protein recognized by monoclonal antibodies and polyclonal human sera by a high throughput assay.

    ID: 1911107

    Description: epitope description:W101, F108, V122, T293 antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 22235356;

  20. B cells that produce immunoglobulin E mediate colitis in BALB/c mice.

    ID: 1911166

    Description: epitope description:4-(ethoxymethylene)-2-phenyloxazol-5-one host organism:Mus musculus BALB/c

    Publication: 21983080;

  21. Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10.

    ID: 1911177

    Description: epitope description:NWFDITNWLWYIK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:4E10

    Publication: 17125793;

  22. Structural basis of enhanced binding of extended and helically constrained peptide epitopes of the broadly neutralizing HIV-1 antibody 4E10.

    ID: 1911178

    Description: epitope description:NWFDITNWLWYIK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:4E10

    Publication: 17125793;

  23. DA-9601 suppresses 2, 4-dinitrochlorobenzene and dust mite extract-induced atopic dermatitis-like skin lesions.

    ID: 1911183

    Description: epitope description:2,6-dinitrophenol host organism:Mus musculus BALB/c

    Publication: 21511060;

  24. Epitope based recombinant BCG vaccine elicits specific Th1 polarized immune responses in BALB/c mice.

    ID: 1915615

    Description: epitope description:EGWWPTLIGLAMNDS antigen name:Diacylglycerol acyltransferase/mycolyltransferase Ag85C host organism:Cavia porcellus Duncan-Hartley

    Publication: 22200502;

  25. Structure of an antibody in complex with its mucin domain linear epitope that is protective against Ebola virus.

    ID: 1917071

    Description: epitope description:GKLGLITNTIAGVAGLI antigen name:Envelope glycoprotein host organism:Mus musculus BALB/c antibody name:14G7

    Publication: 22171276;

  26. Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

    ID: 1917082

    Description: epitope description:QQEKNEQELLELDKWASLWN + AMID(N20) antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:13H11

    Publication: 21076400;

  27. Crystal structure of a non-neutralizing antibody to the HIV-1 gp41 membrane-proximal external region.

    ID: 1917084

    Description: epitope description:QQEKNEQELLELDKWASLWN + AMID(N20) antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:13H11

    Publication: 21076400;

  28. Scorpion-toxin mimics of CD4 in complex with human immunodeficiency virus gp120 crystal structures, molecular mimicry, and neutralization breadth.

    ID: 1917096

    Description: epitope description:C118, V119, L121, V196, T198, Q199, A200, R406, R406, I407, K408, Q409, I410, M421, P424 antigen name:Envelope glycoprotein gp160 ...

    Publication: 15893666;

  29. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917098

    Description: epitope description:TTVESHGKIGATQAGRF antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  30. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917103

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  31. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917108

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  32. Induction of virus-specific neutralizing immune response against West Nile and Japanese encephalitis viruses by chimeric peptides representing T-helpe...

    ID: 1917110

    Description: epitope description:TLDVRMINIEASQLA antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 21889960;

  33. Antibody 2G12 recognizes di-mannose equivalently in domain- and nondomain-exchanged forms but only binds the HIV-1 glycan shield if domain exchanged.

    ID: 1917127

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp host organism:Homo sapiens antibody name:2G12 I19R

    Publication: 20702629;

  34. Antibody 2G12 recognizes di-mannose equivalently in domain- and nondomain-exchanged forms but only binds the HIV-1 glycan shield if domain exchanged.

    ID: 1917129

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp host organism:Homo sapiens antibody name:2G12 I19R

    Publication: 20702629;

  35. Structural basis of HIV-1 resistance to AZT by excision.

    ID: 1922176

    Description: epitope description:R199, Q222, K223, E224, P225, P226, F227, L228, W229, M230, R358 antigen name:Gag-Pol polyprotein host organism:Mus musculus BALB/...

    Publication: 20852643;

  36. Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.

    ID: 1922183

    Description: epitope description:PKLEPWKHP antigen name:Protein Tat host organism:Mus musculus antibody name:11H6H1

    Publication: 21035463;

  37. Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.

    ID: 1922186

    Description: epitope description:PKLEPWKHP antigen name:Protein Tat host organism:Mus musculus antibody name:11H6H1

    Publication: 21035463;

  38. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922208

    Description: epitope description:alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  39. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922211

    Description: epitope description:beta-D-Man-(1->2)-beta-D-Man-(1->2)-beta-D-Man-(1->2)-alpha-D-Man antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  40. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922213

    Description: epitope description:alpha-D-Manp-(1->3)-alpha-D-Manp-(1->2)-alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  41. Biotin sulfone tagged oligomannosides as immunogens for eliciting antibodies against specific mannan epitopes.

    ID: 1922215

    Description: epitope description:alpha-D-Manp-(1->2)-alpha-D-Manp antigen name:mannan host organism:Mus musculus BALB/c

    Publication: 22326546;

  42. Conserved structural elements in the V3 crown of HIV-1 gp120.

    ID: 1922222

    Description: epitope description:KRKRIHIGPGRAFYTTK antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:1006-15D

    Publication: 20622876;

  43. Conserved structural elements in the V3 crown of HIV-1 gp120.

    ID: 1922225

    Description: epitope description:TRKGIHIGPGRAFYATGQITGD antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:3074

    Publication: 20622876;

  44. Elicitation of structure-specific antibodies by epitope scaffolds.

    ID: 1922230

    Description: epitope description:LLELDKWA antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:2F5

    Publication: 20876137;

  45. Elicitation of structure-specific antibodies by epitope scaffolds.

    ID: 1922430

    Description: epitope description:LLELDKWA antigen name:Envelope glycoprotein gp160 host organism:Mus musculus BALB/c antibody name:11F10

    Publication: 20876137;

  46. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922435

    Description: epitope description:TDGVCFPHHK antigen name:sigma-B protein host organism:Mus musculus BALB/c antibody name:2F7

    Publication: 22197425;

  47. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922449

    Description: epitope description:YIRTPACWD antigen name:sigma-B protein host organism:Mus musculus BALB/c

    Publication: 22197425;

  48. Antigenic analysis monoclonal antibodies against different epitopes of σB protein of Muscovy duck reovirus.

    ID: 1922451

    Description: epitope description:YIRTPACWD antigen name:sigma-B protein host organism:Mus musculus BALB/c antibody name:1E5

    Publication: 22197425;

  49. Crystal structure of HIV-1 primary receptor CD4 in complex with a potent antiviral antibody.

    ID: 1927495

    Description: epitope description:V28, S56, K75, I101, E102, S104, D105, Q119, L121, S145, P147, G148, S149, S150, P151, S152, G165, G166, K167, L187, Q188, N189, Q...

    Publication: 21134642;

  50. Localization of linear B-cell epitopes on goose parvovirus structural protein.

    ID: 1927503

    Description: epitope description:SQSVSPDREPERKDNNRGFVLPGYKYLGPGNGLDKGP antigen name:VP1 host organism:Anser sp.

    Publication: 22209204;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston