Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507590

    Description: epitope description:LRYVVWADDW host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;

  2. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507591

    Description: epitope description:NEEPIAPYHFDLSGHAFG antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  3. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507620

    Description: epitope description:SASFNLVGLFGNNENQTKVSNGAFVPNMSLDQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  4. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507625

    Description: epitope description:TGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDAD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  5. Synthetic, immunological and structural studies on repeat unit peptides of Plasmodium falciparum antigens.

    ID: 1507655

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus

    Publication: 2090643;

  6. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507661

    Description: epitope description:IPKARRPEGRTWAQPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  7. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507662

    Description: epitope description:IPKDRRSTGKSWGKPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  8. Mapping of domains on the human parainfluenza virus type 2 nucleocapsid protein (NP) required for NP-phosphoprotein or NP-NP interaction.

    ID: 1507680

    Description: epitope description:MTDIDIVTGNITEGSYKGVELAKLGKQTLLTRFTSNEPVSSAGSAQDPNFKRGG antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibod...

    Publication: 10466799;

  9. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507682

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c antibody name:12A1, 13F1

    Publication: 9034147;

  10. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507685

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c

    Publication: 9034147;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston