Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508514

    Description: epitope description:QPMGPQPMGPQPMEP antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  2. A major Litomosoides carinii microfilarial sheath glycoprotein (gp22): amino terminal sequence and immunological studies with corresponding synthetic ...

    ID: 1508515

    Description: epitope description:QPMGPQPMGPQPMEP antigen name:Major microfilarial sheath protein host organism:Oryctolagus cuniculus

    Publication: 1780176;

  3. Coxsackievirus-induced chronic myocarditis in murine models.

    ID: 1508534

    Description: epitope description:EEGKILRAQLEFNQIKAE antigen name:Myosin-7 host organism:Mus musculus C3H/He

    Publication: 8682103;

  4. Biochemical and immunological characterization of recombinant allergen Lol p 1.

    ID: 1508539

    Description: epitope description:GMTGCGNTPIFKDGRGCG antigen name:Lol p 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9395340;

  5. Biochemical and immunological characterization of recombinant allergen Lol p 1.

    ID: 1508542

    Description: epitope description:TKPESCSGEAVTVTITDD antigen name:Lol p 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9395340;

  6. Coxsackievirus-induced chronic myocarditis in murine models.

    ID: 1508546

    Description: epitope description:TSAHLERMKKNMEQTIKDL antigen name:Myosin-7 host organism:Mus musculus C3H/He

    Publication: 8682103;

  7. Common epitopes in the circumsporozoite proteins of Plasmodium berghei and Plasmodium gallinaceum identified by monoclonal antibodies to the P. gallin...

    ID: 1508557

    Description: epitope description:EKIERNNKLKQPPPPPNPN antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus BALB/c antibody name:N2H1D5, N...

    Publication: 7681341;

  8. Identification of an antigenic peptide specific for bluetongue virus using phage display expression of NS1 sequences.

    ID: 1508658

    Description: epitope description:KQNFERAMIAATDAEEPAKAYKLVELAK antigen name:Non-structural protein NS1 host organism:Oryctolagus cuniculus

    Publication: 9373350;

  9. Dynamics of natural antibody responses to malaria parasite surface proteins in the intermediate rainfall zone of Sri Lanka.

    ID: 1508715

    Description: epitope description:TAADTPTATESISPSPP antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Homo sapiens

    Publication: 7729852;

  10. Epitopes and active sites of the RecA protein.

    ID: 1508756

    Description: epitope description:EGENVVGSETRVKVVKNKIAAPFK antigen name:Protein RecA host organism:Mus musculus BALB/c antibody name:ARM414

    Publication: 1692839;

  11. Isolation and epitope characterization of human monoclonal antibodies to hepatitis C virus core antigen.

    ID: 1508926

    Description: epitope description:VYLLPR antigen name:Genome polyprotein host organism:Homo sapiens antibody name:U1/F10

    Publication: 7515376;

  12. Synthetic, immunological and structural studies on repeat unit peptides of Plasmodium falciparum antigens.

    ID: 1508932

    Description: epitope description:VNDEEDTNDEEDTNDDED antigen name:101 kDa malaria antigen host organism:Oryctolagus cuniculus

    Publication: 2090643;

  13. Mapping of two immunodominant antigenic epitopes conserved among the major inner capsid protein, VP7 of five bluetongue viruses.

    ID: 1508947

    Description: epitope description:LTRAIARAAYV antigen name:Core protein VP7 host organism:Oryctolagus cuniculus

    Publication: 2171194;

  14. Fine mapping of a continuous epitope on VP7 of bluetongue virus using overlapping synthetic peptides and a random epitope library.

    ID: 1508951

    Description: epitope description:TAEIFNV antigen name:Core protein VP7 host organism:Mus musculus BALB/c antibody name:F10

    Publication: 7505073;

  15. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506748

    Description: epitope description:NKTWYL host organism:Equus caballus

    Publication: 9766888;

  16. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506749

    Description: epitope description:NKNWWS host organism:Equus caballus

    Publication: 9766888;

  17. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506754

    Description: epitope description:LNGLVL host organism:Equus caballus

    Publication: 9766888;

  18. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506761

    Description: epitope description:GERVGY host organism:Equus caballus

    Publication: 9766888;

  19. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506765

    Description: epitope description:NKLSAA host organism:Equus caballus

    Publication: 9766888;

  20. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506766

    Description: epitope description:RKFLAA host organism:Equus caballus

    Publication: 9766888;

  21. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506775

    Description: epitope description:SIPIGS host organism:Equus caballus

    Publication: 9766888;

  22. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506778

    Description: epitope description:YKGHLH host organism:Equus caballus

    Publication: 9766888;

  23. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506784

    Description: epitope description:TDLRYL host organism:Equus caballus

    Publication: 9766888;

  24. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506788

    Description: epitope description:STLSKS host organism:Equus caballus

    Publication: 9766888;

  25. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506831

    Description: epitope description:KASAMYSGKGPLNDLRVKI antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  26. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506867

    Description: epitope description:KKKEEGEDDTARQEIRKAW antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  27. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506869

    Description: epitope description:RQEIRKAWVKGMPYMDFSK antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  28. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506875

    Description: epitope description:RKRNGVDVDPNKGKWKEHI antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  29. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506879

    Description: epitope description:VDVDPNKGKWKEHIKEVTE antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  30. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506885

    Description: epitope description:DYGEILTEKVEDLYKGVLL antigen name:capsid VP2 host organism:Mus musculus

    Publication: 11562535;

  31. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506893

    Description: epitope description:GLPEGTPKDPILRSLAYSNANKECQKLLQA antigen name:Gag-Pro-Pol polyprotein host organism:Homo sapiens

    Publication: 1537894;

  32. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506903

    Description: epitope description:EVDKDISQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLF antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  33. Linear antigenic regions of the structural proteins of human T-cell lymphotropic virus type I detected by enzyme-linked immunosorbent assays using syn...

    ID: 1506906

    Description: epitope description:GWGLNWDLGLSQWAREALQTGIT antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 1537894;

  34. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506930

    Description: epitope description:LRVKIERDDLSRETIIQII antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  35. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506933

    Description: epitope description:KLVEYCDFLTTFVHAKKKE antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  36. Definition of neutralizing sites on African horse sickness virus serotype 4 VP2 at the level of peptides.

    ID: 1506937

    Description: epitope description:RKRNGVDVDPNKGKWKEHI antigen name:capsid VP2 host organism:Oryctolagus cuniculus

    Publication: 11562535;

  37. Localization of a surface domain of the capsid protein of barley yellow dwarf virus.

    ID: 1506965

    Description: epitope description:RKGRGGANPVFRPTGGTEVF antigen name:Major capsid protein host organism:Mus musculus antibody name:P-PAV 1C2, P-PAV 2A5, P-PAV 3A11

    Publication: 1727606;

  38. Protection against measles virus-induced encephalitis by antibodies from mice immunized intranasally with a synthetic peptide immunogen.

    ID: 1506990

    Description: epitope description:INQDPDKILTY antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c

    Publication: 9607021;

  39. Identification of the immunodominant T cell epitope of p38, a major egg antigen, and characterization of the epitope-specific Th responsiveness during...

    ID: 1507032

    Description: epitope description:KSDNQIKAVPASQAL antigen name:Putative major egg antigen host organism:Mus musculus CBA/J

    Publication: 9605143;

  40. Definition and mapping of epitopes recognized by specific monoclonal antibodies to Schistosoma bovis 28 kDa glutathione S-transferase: relation with a...

    ID: 1507041

    Description: epitope description:ITDNHGHVKW antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/c antibody name:Sb4-10

    Publication: 10081767;

  41. Definition and mapping of epitopes recognized by specific monoclonal antibodies to Schistosoma bovis 28 kDa glutathione S-transferase: relation with a...

    ID: 1507056

    Description: epitope description:ITDNHGHVKW antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Mus musculus BALB/c

    Publication: 10081767;

  42. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1507130

    Description: epitope description:GANSTA antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 9243289;

  43. B cell responses to a peptide epitope. II: Multiple levels of selection during maturation of primary responses.

    ID: 1507135

    Description: epitope description:NST antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:608, 609

    Publication: 9243289;

  44. Measurement of gluten using a monoclonal antibody to a coeliac toxic peptide of A-gliadin.

    ID: 1507321

    Description: epitope description:LGQQQPFPPQQPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody ...

    Publication: 10189843;

  45. Measurement of gluten using a monoclonal antibody to a coeliac toxic peptide of A-gliadin.

    ID: 1507325

    Description: epitope description:LGQQQPFPPQQPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody ...

    Publication: 10189843;

  46. Measurement of gluten using a monoclonal antibody to a coeliac toxic peptide of A-gliadin.

    ID: 1507326

    Description: epitope description:LGQQQPFPPQQPYPQPQPF antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Mus musculus antibody ...

    Publication: 10189843;

  47. Antigenic surface of the bee venom allergen phospholipase A2. Structural functional analysis of human IgG4 antibodies reveals potential role in protec...

    ID: 1507337

    Description: epitope description:K58 antigen name:Api m 1 host organism:Homo sapiens

    Publication: 8189069;

  48. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507348

    Description: epitope description:GLQNDF host organism:Mus musculus BALB/c antibody name:C1.3

    Publication: 9281855;

  49. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507354

    Description: epitope description:WRRWFYQFPTRAWAS host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  50. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507355

    Description: epitope description:QVADKE host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  51. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507366

    Description: epitope description:VMRQECWWWPCNDLY host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  52. Mapping epitopes of neutralizing monoclonal antibodies using phage random peptide libraries.

    ID: 1507367

    Description: epitope description:HPWWTWVSDPNATQP host organism:Mus musculus BALB/c antibody name:C1.8

    Publication: 9281855;

  53. Adherence epitopes of Mycoplasma genitalium adhesin.

    ID: 1507408

    Description: epitope description:PVKDSSKQ antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:6F3

    Publication: 1383392;

  54. Adherence epitopes of Mycoplasma genitalium adhesin.

    ID: 1507415

    Description: epitope description:PVKDSSKQ antigen name:Adhesin P1 host organism:Mus musculus BALB/c antibody name:6F3

    Publication: 1383392;

  55. Localization of antigenic sites of the E2 glycoprotein of transmissible gastroenteritis coronavirus.

    ID: 1507444

    Description: epitope description:G543, V631 antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:1B.B5

    Publication: 2155284;

  56. Structural comparison and epitope analysis of outer-membrane protein PIA from strains of Neisseria gonorrhoeae with differing serovar specificities.

    ID: 1507456

    Description: epitope description:GTEKF antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Mus musculus antibody name:5G9

    Publication: 7506294;

  57. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507466

    Description: epitope description:DQKPPSRQSQIESR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  58. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507473

    Description: epitope description:GPNLVLPDQK antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  59. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507474

    Description: epitope description:GPKRIRTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  60. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507479

    Description: epitope description:RRWQQRNTPFY antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  61. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507487

    Description: epitope description:DQKPPSRQSQIESR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  62. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507489

    Description: epitope description:SPKRIGTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  63. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507491

    Description: epitope description:YTHFAKAARFRR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  64. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507492

    Description: epitope description:EKSLTSLSE antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  65. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507497

    Description: epitope description:KLRERLKQR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  66. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507502

    Description: epitope description:GPKRIRTGDR antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  67. Epitope analysis of soybean major allergen Gly m Bd 30K recognized by the mouse monoclonal antibody using overlapping peptides.

    ID: 1507504

    Description: epitope description:QGGCGRGWAFSATGAIEA antigen name:P34 probable thiol protease host organism:Mus musculus BALB/c antibody name:H6

    Publication: 8782415;

  68. Virus neutralizing and enhancing epitopes characterized by synthetic oligopeptides derived from the feline leukaemia virus glycoprotein sequence.

    ID: 1507511

    Description: epitope description:EKSLTSLSEVVLQNRRGLD antigen name:Env polyprotein host organism:Oryctolagus cuniculus

    Publication: 1689371;

  69. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507520

    Description: epitope description:TKLAQYQAELKRVQEANAA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  70. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507526

    Description: epitope description:DLAAVKKANAANEADYQAK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  71. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507540

    Description: epitope description:GILWEGFGGDPCDPCTTWVDAISMRMGYYGDFVFDRVLKTDVNKEFQMGA antigen name:Major outer membrane porin, serovar D host organism:Mus musculus B...

    Publication: 1712817;

  72. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507541

    Description: epitope description:AYQKALAAYQAELKRVQEA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  73. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507554

    Description: epitope description:AANNAANAALTAENTAIKK antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  74. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507558

    Description: epitope description:TNAANQAAYQKALAAYQAE antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  75. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507561

    Description: epitope description:IKQRNENAKATYEAALKQY antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  76. Identification of human antigenic epitopes in an alanine-rich repeating region using sera from hu-PBL-SCID mice immunized with a surface protein antig...

    ID: 1507563

    Description: epitope description:AALTAENTAIKKRNADAKA antigen name:UniProt:I6TX52 host organism:Homo sapiens

    Publication: 9028261;

  77. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507564

    Description: epitope description:APYHFDLSGHAFGAM antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  78. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507565

    Description: epitope description:YDWLMF host organism:Mus musculus BALB/c antibody name:12A1

    Publication: 9034147;

  79. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507575

    Description: epitope description:LDWLWEWAEQ host organism:Mus musculus BALB/c antibody name:13F1

    Publication: 9034147;

  80. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507582

    Description: epitope description:AVWQWMWVEY host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;

  81. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507590

    Description: epitope description:LRYVVWADDW host organism:Mus musculus BALB/c antibody name:12A1, 13F1, 21D2

    Publication: 9034147;

  82. Isolation of an immunodominant IgE hapten from an epitope expression cDNA library. Dissection of the allergic effector reaction.

    ID: 1507591

    Description: epitope description:NEEPIAPYHFDLSGHAFG antigen name:Phl p 1 host organism:Homo sapiens

    Publication: 7525573;

  83. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507620

    Description: epitope description:SASFNLVGLFGNNENQTKVSNGAFVPNMSLDQ antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  84. A single peptide from the major outer membrane protein of Chlamydia trachomatis elicits T cell help for the production of antibodies to protective det...

    ID: 1507625

    Description: epitope description:TGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRASFDAD antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1712817;

  85. Synthetic, immunological and structural studies on repeat unit peptides of Plasmodium falciparum antigens.

    ID: 1507655

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus

    Publication: 2090643;

  86. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507661

    Description: epitope description:IPKARRPEGRTWAQPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  87. Two distinct subtypes of hepatitis C virus defined by antibodies directed to the putative core protein.

    ID: 1507662

    Description: epitope description:IPKDRRSTGKSWGKPGY antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 1383117;

  88. Mapping of domains on the human parainfluenza virus type 2 nucleocapsid protein (NP) required for NP-phosphoprotein or NP-NP interaction.

    ID: 1507680

    Description: epitope description:MTDIDIVTGNITEGSYKGVELAKLGKQTLLTRFTSNEPVSSAGSAQDPNFKRGG antigen name:Human rubulavirus 2 protein host organism:Mus musculus antibod...

    Publication: 10466799;

  89. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507682

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c antibody name:12A1, 13F1

    Publication: 9034147;

  90. Epitope location in the Cryptococcus neoformans capsule is a determinant of antibody efficacy.

    ID: 1507685

    Description: epitope description:RAVIWAWMWE host organism:Mus musculus BALB/c

    Publication: 9034147;

  91. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507686

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  92. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507687

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  93. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507688

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:A1, A4

    Publication: 1713262;

  94. The humoral immune response to human T-cell lymphotropic virus type 1 envelope glycoprotein gp46 is directed primarily against conformational epitopes...

    ID: 1507690

    Description: epitope description:LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:PRH-1

    Publication: 9882322;

  95. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507728

    Description: epitope description:TLLTLCPATCILPLGEPFS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  96. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507731

    Description: epitope description:SNEPPLSEFELPPIQTPGLS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  97. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507741

    Description: epitope description:SNDVTIDAWCPLCGPHERLQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  98. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507744

    Description: epitope description:ETHRINWTADGRPCGLNGTL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  99. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507747

    Description: epitope description:PQGPRRLWINCPLPAVRAQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  100. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507749

    Description: epitope description:GPVSLSPFERSPFQPYQCQL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston