Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507686

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  2. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507687

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:30B

    Publication: 1713262;

  3. Localization of antigenic sites on the surface glycoprotein of mouse hepatitis virus.

    ID: 1507688

    Description: epitope description:IPRSRQIDLQIG antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:A1, A4

    Publication: 1713262;

  4. The humoral immune response to human T-cell lymphotropic virus type 1 envelope glycoprotein gp46 is directed primarily against conformational epitopes...

    ID: 1507690

    Description: epitope description:LALPAPHLTLPFNWTHCFDPQIQAIVSSPCHNSLI antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens antibody name:PRH-1

    Publication: 9882322;

  5. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507728

    Description: epitope description:TLLTLCPATCILPLGEPFS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  6. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507731

    Description: epitope description:SNEPPLSEFELPPIQTPGLS antigen name:p34 host organism:Mus musculus BALB/c

    Publication: 9637294;

  7. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507741

    Description: epitope description:SNDVTIDAWCPLCGPHERLQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  8. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507744

    Description: epitope description:ETHRINWTADGRPCGLNGTL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  9. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507747

    Description: epitope description:PQGPRRLWINCPLPAVRAQ antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  10. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507749

    Description: epitope description:GPVSLSPFERSPFQPYQCQL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston