Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328157

    Description: epitope description:DTPPVPDVDSRGAILRRQYNLSTSPLTSSV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  2. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328161

    Description: epitope description:ARATIRYRPLVPNAVGGYAISISFWPQTTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  3. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328166

    Description: epitope description:SVDMNSITSTDVRILVQPGIASELVIPSER antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  4. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328171

    Description: epitope description:VIPSERLHYRNQGWRSVETSGVAEEEATSG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  5. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328176

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  6. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328178

    Description: epitope description:DFALELEFRNLTPGNTNTRVSRYSSTARHR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  7. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328193

    Description: epitope description:DYDNQHEQDRPTPSPAPSRPFSVLRANDVL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  8. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328194

    Description: epitope description:DRPTPSPAPSRPFSVLRANDVLWLSLTAAE antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  9. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328195

    Description: epitope description:APSRPFSVLRANDVLWLSLTAAEYDQSTYG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  10. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328197

    Description: epitope description:NAAGHRVAISTYTTSLGAGPVSISAVAVLA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  11. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328200

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  12. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328207

    Description: epitope description:GSPVNSYTNTPYTGALGLLDFALELEFRNL antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  13. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328211

    Description: epitope description:GNTNTRVSRYSSTARHRLRRGADGTAELTT antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  14. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328225

    Description: epitope description:RANDVLWLSLTAAEYDQSTYGSSTGPVYVS antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  15. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328227

    Description: epitope description:STYGSSTGPVYVSDSVTLVNVATGAQAVAR antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  16. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328229

    Description: epitope description:VLPLRGKLSFWEAGTTKAGYPYNYNTTASD antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  17. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328233

    Description: epitope description:LAPHSALALLEDTMDYPARAHTFDDFCPEC antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  18. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328234

    Description: epitope description:LEDTMDYPARAHTFDDFCPECRPLGLQGCA antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  19. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328235

    Description: epitope description:DYPARAHTFDDFCPECRPLGLQGCAFQSTV antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;

  20. Antigenic domains of the open reading frame 2-encoded protein of hepatitis E virus.

    ID: 1328237

    Description: epitope description:FCPECRPLGLQGCAFQSTVAELQRLKMKVG antigen name:Capsid protein host organism:Homo sapiens antibody name:Human sera

    Publication: 10449466;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston