Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936227

    Description: epitope description:EPKLLAFSAPSPGDTVTAVKRSS antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  2. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936230

    Description: epitope description:LLVAMIPEYLSTAQQDFLGSWRDKTTDSTPGTWVWNTYEAFPPGFPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  3. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936232

    Description: epitope description:SGDTPLNIFSTLHRKLDNSVRDY antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  4. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936235

    Description: epitope description:VNARPLTQLKGADDEP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  5. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936238

    Description: epitope description:SGDTLLAPFYMPNHKLDKNTRDY antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  6. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936240

    Description: epitope description:IPTSFCGYGDYLRKPESFGKA antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  7. Mapping B-cell epitopes in equine rhinitis B viruses and identification of a neutralising site in the VP1 C-terminus.

    ID: 1936242

    Description: epitope description:LLVVMVPEYVATSQTDFRGSWQDKDTDNLPGAWMWQTYDALPSTLPP antigen name:Genome polyprotein host organism:Rattus norvegicus

    Publication: 21930350;

  8. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935900

    Description: epitope description:HEVDLWTTLGAG antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  9. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935902

    Description: epitope description:TTLGAGSTGLTF antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  10. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935903

    Description: epitope description:TTLGAGSTGLTF antigen name:Stachybotrys chartarum protein host organism:Homo sapiens

    Publication: 22424314;

  11. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935911

    Description: epitope description:AKQMWPAESRKP host organism:Homo sapiens

    Publication: 22424314;

  12. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935922

    Description: epitope description:VKQMWPAASRKP host organism:Homo sapiens

    Publication: 22424314;

  13. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935924

    Description: epitope description:VKQMWPAEARKP host organism:Homo sapiens

    Publication: 22424314;

  14. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935926

    Description: epitope description:VKQMWPAESAKP host organism:Homo sapiens

    Publication: 22424314;

  15. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935928

    Description: epitope description:VKQMWPAESRAP host organism:Homo sapiens

    Publication: 22424314;

  16. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935931

    Description: epitope description:VKQMWPAESRKA host organism:Homo sapiens

    Publication: 22424314;

  17. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935936

    Description: epitope description:MWAAESRKPMSG host organism:Homo sapiens

    Publication: 22424314;

  18. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935939

    Description: epitope description:MWPAASRKPMSG host organism:Homo sapiens

    Publication: 22424314;

  19. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935941

    Description: epitope description:MWPAEARKPMSG host organism:Homo sapiens

    Publication: 22424314;

  20. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935947

    Description: epitope description:MWPAESRKAMSG host organism:Homo sapiens

    Publication: 22424314;

  21. Sta c 3 epitopes and their application as biomarkers to detect specific IgE.

    ID: 1935948

    Description: epitope description:MWPAESRKPASG host organism:Homo sapiens

    Publication: 22424314;

  22. Functional epitope core motif of the Anaplasma marginale major surface protein 1a and its incorporation onto bioelectrodes for antibody detection.

    ID: 1935958

    Description: epitope description:SEASTSSQLGA antigen name:Major surface protein 1a (MSP1A) host organism:Bos taurus

    Publication: 22427942;

  23. Minor interference of cross-reactive carbohydrates with the diagnosis of respiratory allergy in standard clinical conditions.

    ID: 1935969

    Description: epitope description:alpha-L-Fucp-(1->3)-[alpha-D-Manp-(1->6)-[beta-D-Xylp-(1->2)]-beta-D-Manp-(1->4)-beta-D-GlcpNAc-(1->4)]-D-GlcpNAc antigen name:Ana...

    Publication: 21986086;

  24. Characterization of periplasmic protein BP26 epitopes of Brucella melitensis reacting with murine monoclonal and sheep antibodies.

    ID: 1935982

    Description: epitope description:NIQPIYVYPDDKNNLK antigen name:26 kDa periplasmic immunogenic protein host organism:Mus musculus BALB/c antibody name:2H9, 5F12

    Publication: 22457830;

  25. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936003

    Description: epitope description:TYDSTAGEGVVFY antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  26. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936033

    Description: epitope description:VCTIAASTSTDGSASFTNFGSVVD antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  27. Identification of critical amino acids in an immunodominant IgE epitope of Pen c 13, a major allergen from Penicillium citrinum.

    ID: 1936042

    Description: epitope description:IVQLATSSISR antigen name:Penicillium citrinum protein host organism:Homo sapiens

    Publication: 22506037;

  28. Lytic anti-alpha-galactosyl antibodies from patients with chronic Chagas' disease recognize novel O-linked oligosaccharides on mucin-like glycosyl-pho...

    ID: 1811760

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group antigen name:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-b...

    Publication: 7818483;

  29. Experimental therapy of African trypanosomiasis with a nanobody-conjugated human trypanolytic factor.

    ID: 1811764

    Description: epitope description:alpha-D-Man-(1->2)-alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1->3)-[alpha-D-Man-(1->2)-alpha-D-Man-(1...

    Publication: 16604085;

  30. Further studies on the chemical basis for serological specificity of Group A streptococcal carbohydrate.

    ID: 1811770

    Description: epitope description:N-acetyl-D-glucosamine antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 13575668;

  31. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811773

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  32. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811774

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  33. Evaluation of progesterone-ovalbumin conjugates with different length linkers in enzyme-linked immunosorbant assay and surface plasmon resonance-based...

    ID: 1811775

    Description: epitope description:2,5-dioxo-1-pyrrolidinyl 6-(6-{3-[(progesterone-4-yl)thiopropionyl]aminohexanoyl}amino)hexanoate host organism:Rattus norvegicus

    Publication: 11996928;

  34. Three-dimensional structure of an anti-steroid Fab' and progesterone-Fab' complex.

    ID: 1811779

    Description: epitope description:corticosterone host organism:Mus musculus BALB/c antibody name:DB3

    Publication: 8496956;

  35. Ig knock-in mice producing anti-carbohydrate antibodies: breakthrough of B cells producing low affinity anti-self antibodies.

    ID: 1811808

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Mus musculus C57BL/6 GalNAc Transferase null

    Publication: 18322191;

  36. Ganglioside complexes containing GQ1b as targets in Miller Fisher and Guillain-Barre syndromes.

    ID: 1811816

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 18339728;

  37. Ganglioside complexes containing GQ1b as targets in Miller Fisher and Guillain-Barre syndromes.

    ID: 1811817

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 18339728;

  38. Alpha-galactosyl antibody redistributes alpha-galactosyl at the surface of pig blood and endothelial cells.

    ID: 1811822

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10544440;

  39. Autoantibodies against N-homocysteinylated proteins in humans: implications for atherosclerosis.

    ID: 1811848

    Description: epitope description:N(6)-L-homocysteinyl-L-lysine host organism:Homo sapiens

    Publication: 15131313;

  40. Detection of beta-amyloid peptide (1-16) and amyloid precursor protein (APP770) using spectroscopic ellipsometry and QCM techniques: a step forward to...

    ID: 1811867

    Description: epitope description:DAEFRHDSGYEVHHQK antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:DE2

    Publication: 20692146;

  41. X-ray structure of a voltage-dependent K+ channel.

    ID: 1811877

    Description: epitope description:Y67, L68, L71, Y72, E120, A124, G125, L126, G127, L128, F129, R130, V132, R136 antigen name:Voltage-gated potassium channel host o...

    Publication: 12721618;

  42. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1811885

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:Other Homo sapiens (human) protein host o...

    Publication: 8675304;

  43. Potential role of molecular mimicry between Helicobacter pylori lipopolysaccharide and host Lewis blood group antigens in autoimmunity.

    ID: 1811890

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:Other Homo sapiens (human) protein host o...

    Publication: 8675304;

  44. Structure of lactococcal phage p2 baseplate and its mechanism of activation.

    ID: 1811893

    Description: epitope description:H: Q198, K199, G200, W201, N202, W207, V217, S219, H232, D234, N236, P237, N238, S240, T242, W244; I: A225, R256 antigen name:Lact...

    Publication: 20351260;

  45. Campylobacter jejuni lipopolysaccharides in Guillain-Barré syndrome: molecular mimicry and host susceptibility.

    ID: 1811912

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 9710005;

  46. Further studies on the chemical basis for serological specificity of Group A streptococcal carbohydrate.

    ID: 1811916

    Description: epitope description:phenyl N-acetyl-beta-D-glucosaminide antigen name:polysaccharide host organism:Oryctolagus cuniculus

    Publication: 13575668;

  47. Carrier-specificity of a phosphorylcholine-binding antibody requires the presence of the constant domains and is not dependent on the unique VH49 glyc...

    ID: 1811934

    Description: epitope description:phosphocholine host organism:Mus musculus BALB/c antibody name:Mab2 Fab

    Publication: 17331532;

  48. Monoclonal antibodies against an arabinogalactan-protein from pressed juice of Echinacea purpurea.

    ID: 1811941

    Description: epitope description:alpha-L-Araf-(1->2)-[alpha-L-Araf-(1->5)-alpha-L-Araf-(1->2)-[beta-D-Galp-(1->6)]-beta-D-Galp-(1->6)-beta-D-Galp-(1->6)-beta-D-Gal...

    Publication: 15386194;

  49. Monoclonal antibodies against an arabinogalactan-protein from pressed juice of Echinacea purpurea.

    ID: 1811945

    Description: epitope description:alpha-L-Araf-(1->2)-[alpha-L-Araf-(1->5)-alpha-L-Araf-(1->2)-[beta-D-Galp-(1->6)]-beta-D-Galp-(1->6)-beta-D-Galp-(1->6)-beta-D-Gal...

    Publication: 15386194;

  50. Hepatitis C virus with a naturally occurring single amino-acid substitution in the E2 envelope protein escapes neutralization by naturally-induced and...

    ID: 1811952

    Description: epitope description:QLINTNGSWHINSTA antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 20433800;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston