Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506249

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  2. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506251

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  3. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506266

    Description: epitope description:DDPPATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  4. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506269

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  5. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506270

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  6. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506271

    Description: epitope description:GALATYQSEYLAHRRIPP antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  7. Location of the Bombyx mori aminopeptidase N type 1 binding site on Bacillus thuringiensis Cry1Aa toxin.

    ID: 1506280

    Description: epitope description:NEVYIDRIEFVPAEVTFEAEYD antigen name:Other Bacillus thuringiensis protein host organism:Mus musculus BALB/c antibody name:1E10

    Publication: 16000811;

  8. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506369

    Description: epitope description:KVSFFCKNKEKKCSY antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  9. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506370

    Description: epitope description:SCKLPVKKATVVYQGERVKIQ antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  10. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506371

    Description: epitope description:VHTWTEQYK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3 AND 1C6.3

    Publication: 18160621;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston