Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Hsp70 vaccination-induced antibodies recognize B cell epitopes in the cell wall of Mycobacterium avium subspecies paratuberculosis.

    ID: 1818748

    Description: epitope description:AQAGGPDGAAAGGG antigen name:Chaperone protein DnaK host organism:Capra hircus Saanen

    Publication: 21199702;

  2. Characterization of the epitope recognized by a monoclonal antibody highly specific for blood group M antigen.

    ID: 1818755

    Description: epitope description:S20 antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:M2A1

    Publication: 1690467;

  3. Human monoclonal antibody with T-cell-like specificity recognizes MHC class I self-peptide presented by HLA-DR1 on activated cells.

    ID: 1818761

    Description: epitope description:SDWRFLRGYHQYA antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Homo sapiens antibody name:UL-5A1

    Publication: 9550326;

  4. Genetics of the phosphocholine-specific antibody response to Streptococcus pneumoniae. Germ-line but not mutated T15 antibodies are dominantly selecte...

    ID: 1818773

    Description: epitope description:phosphocholine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:252.5E10; 252.5E11; 174.2E10; 253.12D3;...

    Publication: 3141511;

  5. Rational design and immunogenicity of liposome-based diepitope constructs: application to synthetic oligosaccharides mimicking the Shigella flexneri 2...

    ID: 1818778

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-...

    Publication: 19559116;

  6. Rational design and immunogenicity of liposome-based diepitope constructs: application to synthetic oligosaccharides mimicking the Shigella flexneri 2...

    ID: 1818779

    Description: epitope description:alpha-L-Rhap-(1->2)-alpha-L-Rhap-(1->3)-[alpha-D-Glcp-(1->4)]-alpha-L-Rhap-(1->3)-beta-D-GlcpNAc-(1->2)-alpha-L-Rhap-(1->2)-alpha-...

    Publication: 19559116;

  7. Anti-pig IgM antibodies in human serum react predominantly with Gal(alpha 1-3)Gal epitopes.

    ID: 1818780

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactosyl group host organism:Homo sapiens

    Publication: 7504304;

  8. Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

    ID: 1818785

    Description: epitope description:FADGNGDSSTYQYIYNLTICELNG antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 16817772;

  9. Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

    ID: 1818810

    Description: epitope description:CELNGTDWLA antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 16817772;

  10. Neutralizing antibody responses of pigs infected with natural GP5 N-glycan mutants of porcine reproductive and respiratory syndrome virus.

    ID: 1818811

    Description: epitope description:SSHLQLIYNLTLC antigen name:Glycoprotein 5 host organism:Sus scrofa

    Publication: 16817772;

  11. Characterization of the epitope recognized by a monoclonal antibody highly specific for blood group M antigen.

    ID: 1818813

    Description: epitope description:S20 antigen name:Glycophorin-A host organism:Mus musculus BALB/c antibody name:M2A1

    Publication: 1690467;

  12. HLA-DR beta chain residues that are predicted to be located in the floor of the peptide-binding groove contribute to antibody-binding epitopes.

    ID: 1818824

    Description: epitope description:Y5, T7, T46 antigen name:HLA class II histocompatibility antigen, DRB1-11 beta chain host organism:Mus musculus BALB/c antibody na...

    Publication: 7690741;

  13. Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

    ID: 1818889

    Description: epitope description:LQYTPSWMLV host organism:Mus musculus BALB/c

    Publication: 14568972;

  14. Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

    ID: 1818905

    Description: epitope description:FGGETFTPDWMMEV host organism:Mus musculus BALB/c

    Publication: 14568972;

  15. Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

    ID: 1818910

    Description: epitope description:AFTPDWMMEVAIDNE host organism:Mus musculus BALB/c

    Publication: 14568972;

  16. Antibodies to keyhole limpet hemocyanin cross-react with an epitope on the polysaccharide capsule of Cryptococcus neoformans and other carbohydrates: ...

    ID: 1818913

    Description: epitope description:CKVMVHDPHSLA antigen name:H-2 class I histocompatibility antigen, K-B alpha chain host organism:Mus musculus BALB/c

    Publication: 14568972;

  17. A novel glycosphingolipid expressed in pig kidney: Gal alpha 1-3Lewis(x) hexaglycosylceramide.

    ID: 1818965

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Glcp-(1<->1')-Cer hos...

    Publication: 9076511;

  18. A novel glycosphingolipid expressed in pig kidney: Gal alpha 1-3Lewis(x) hexaglycosylceramide.

    ID: 1818968

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-beta-D-Gl...

    Publication: 9076511;

  19. A somatically mutated human antiganglioside IgM antibody that induces experimental neuropathy in mice is encoded by the variable region heavy chain ge...

    ID: 1818973

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 8636426;

  20. Neutralizing human monoclonal antibodies binding multiple serotypes of botulinum neurotoxin.

    ID: 1818981

    Description: epitope description:YNQYTEEEK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:4E17

    Publication: 21149386;

  21. Neutralizing human monoclonal antibodies binding multiple serotypes of botulinum neurotoxin.

    ID: 1818986

    Description: epitope description:YNQYTEEEK antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9) host organism:Homo sapiens antibody name:4E17

    Publication: 21149386;

  22. Further evidence that carbohydrates are the immunodeterminant structures of blood group M and N specificities.

    ID: 1819004

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Equus caballus

    Publication: 6169631;

  23. Recombinant infectious bursal disease virus carrying hepatitis C virus epitopes.

    ID: 1819015

    Description: epitope description:EQKLISEEDL antigen name:Myc proto-oncogene protein (UniProt:P01106) host organism:Mus musculus BALB/c antibody name:Myc1-9E10

    Publication: 21106739;

  24. Improved removal of anti-A and anti-B antibodies from plasma using blood-group-active haptens.

    ID: 1819016

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp host organism:Homo sapiens

    Publication: 8212667;

  25. Improved removal of anti-A and anti-B antibodies from plasma using blood-group-active haptens.

    ID: 1819017

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->4)-beta-D-Glcp host organism:Homo sapiens

    Publication: 8212667;

  26. Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

    ID: 1819023

    Description: epitope description:LFSPWLRVQNHF host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15780718;

  27. Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

    ID: 1819036

    Description: epitope description:AGVLRQEQANSV host organism:Mus musculus BALB/c antibody name:MG96

    Publication: 15780718;

  28. Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

    ID: 1819039

    Description: epitope description:SEAKDGSHGEGK host organism:Mus musculus BALB/c antibody name:MG96

    Publication: 15780718;

  29. Peptide mimics as surrogate immunogens of mosquito midgut carbohydrate malaria transmission blocking targets.

    ID: 1819103

    Description: epitope description:LKGDDSAGEQEL host organism:Mus musculus BALB/c antibody name:MG96

    Publication: 15780718;

  30. Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

    ID: 1819201

    Description: epitope description:TPRVERNGHSVFLAPYGWMVK + GLUC(N7) host organism:Homo sapiens

    Publication: 20564034;

  31. Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

    ID: 1819202

    Description: epitope description:TPRVERQGHSVFLAPYGWMVK + GLUC(Q7) host organism:Homo sapiens

    Publication: 20564034;

  32. Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

    ID: 1819205

    Description: epitope description:D-glucosyl group host organism:Homo sapiens

    Publication: 20564034;

  33. Posttranslationally modified peptides efficiently mimicking neoantigens: a challenge for theragnostics of autoimmune diseases.

    ID: 1819206

    Description: epitope description:D-glucosyl group host organism:Homo sapiens

    Publication: 20564034;

  34. Adduction of cholesterol 5,6-secosterol aldehyde to membrane-bound myelin basic protein exposes an immunodominant epitope.

    ID: 1819212

    Description: epitope description:VVHFFKNIVTPRT antigen name:Myelin basic protein host organism:Mus musculus antibody name:QD9

    Publication: 21314187;

  35. Rapid recruitment and activation of macrophages by anti-Gal/alpha-Gal liposome interaction accelerates wound healing.

    ID: 1819238

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-D-GlcNAc host organism:Mus musculus N-acetylgalactosaminyltransferase null

    Publication: 21357545;

  36. Strain-transcending Fc-dependent killing of Plasmodium falciparum by merozoite surface protein 2 allele-specific human antibodies.

    ID: 1819244

    Description: epitope description:ESSSSGNAPNKTDGKGEESEKQNELNESTEEGPKAPQEPQTAENENPA antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein...

    Publication: 21189324;

  37. Protective immunity against Chlamydia trachomatis genital infection induced by a vaccine based on the major outer membrane multi-epitope human papillo...

    ID: 1819274

    Description: epitope description:GDNENQSTVKTNSVPNMSLDQSVVELYTWQASLALSYRLNMFTPYIGV host organism:Oryctolagus cuniculus

    Publication: 21324344;

  38. Rodents infected with Schistosoma mansoni produce cytolytic IgG and IgM antibodies to the Lewis x antigen.

    ID: 1819311

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc host organism:Mus musculus Swiss Webster

    Publication: 9134427;

  39. Structure of IL-17A in complex with a potent, fully human neutralizing antibody.

    ID: 1819320

    Description: epitope description:A: S63, S64, D65, Y66, R69; B: L97, Y108, H109, M110, N111, P149, I150 antigen name:Interleukin-17A host organism:Homo sapiens ant...

    Publication: 19835883;

  40. Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

    ID: 1819391

    Description: epitope description:KGLRRDLDASREAKKQLEAE antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 21169359;

  41. Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

    ID: 1819392

    Description: epitope description:KGLRRDLDASREAKKQVEKA antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 21169359;

  42. Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

    ID: 1819394

    Description: epitope description:RRDLDASREAKKQLEAEQQK antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 21169359;

  43. Anti-group A streptococcal vaccine epitope: structure, stability, and its ability to interact with HLA class II molecules.

    ID: 1819400

    Description: epitope description:KLEEQNKISEASRKGLRRDL antigen name:UniProt:A2RGM0 host organism:Homo sapiens

    Publication: 21169359;

  44. Immunological evidence for methylglyoxal-derived modifications in vivo. Determination of antigenic epitopes.

    ID: 1824310

    Description: epitope description:methylglyoxal host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9506998;

  45. Immunological evidence for methylglyoxal-derived modifications in vivo. Determination of antigenic epitopes.

    ID: 1824311

    Description: epitope description:methylglyoxal host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9506998;

  46. Expression of a blood group B antigen-related glycoepitope in human dorsal root ganglion cells.

    ID: 1824347

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal antigen name:glycoprotein host organism:Mus musculus antibody name:3E-7

    Publication: 7531759;

  47. Monoclonal antibodies directed to the blood group A associated structure, galactosyl-A: specificity and relation to the Thomsen-Friedenreich antigen.

    ID: 1824352

    Description: epitope description:beta-D-Gal-(1->3-)-alpha-D-GalNAc antigen name:glycolipid host organism:Mus musculus BALB/c antibody name:HH8

    Publication: 3287140;

  48. Monoclonal antibodies directed to the blood group A associated structure, galactosyl-A: specificity and relation to the Thomsen-Friedenreich antigen.

    ID: 1824355

    Description: epitope description:beta-D-Gal-(1->3-)-alpha-D-GalNAc antigen name:glycolipid host organism:Homo sapiens

    Publication: 3287140;

  49. Antigenic structures recognized by anti-beta2-glycoprotein I auto-antibodies.

    ID: 1824522

    Description: epitope description:HNIWSAPRLIFN host organism:Homo sapiens antibody name:EY2C9

    Publication: 16221723;

  50. Antigenic structures recognized by anti-beta2-glycoprotein I auto-antibodies.

    ID: 1824543

    Description: epitope description:SLWQDRLNAMQS host organism:Mus musculus NZW X BXSB antibody name:WB-CAL-1

    Publication: 16221723;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston