Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507756

    Description: epitope description:DPLRLSVFAPDTRGAIRYLS antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  2. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507761

    Description: epitope description:SNEPPLSEFELPPIQTPGLS antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  3. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507762

    Description: epitope description:LPPIQTPGLSWSVPAIDLFL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  4. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507763

    Description: epitope description:WSVPAIDLFLTGPPSPCDRL antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  5. Epitope mapping of bovine leukemia virus transactivator protein Tax.

    ID: 1507768

    Description: epitope description:LDSPLKLQLLENEWLSRLF antigen name:p34 host organism:Mus musculus C57BL/6

    Publication: 9637294;

  6. Murine monoclonal antibodies to PorA of Neisseria meningitidis show reduced protective activity in vivo against B:15:P1.7,16 subtype variants in an in...

    ID: 1505535

    Description: epitope description:ASGQ antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN14C11.6

    Publication: 11273739;

  7. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505569

    Description: epitope description:SVLFDKNRGQEI host organism:Mus musculus antibody name:mAb b4-22, 24/16

    Publication: 16132176;

  8. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505577

    Description: epitope description:YYNKNNASYUSS host organism:Mus musculus antibody name:mAb b4-22, 24/16

    Publication: 16132176;

  9. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505584

    Description: epitope description:QPPQWLWPQKEV host organism:Mus musculus antibody name:mAb a18

    Publication: 16132176;

  10. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505594

    Description: epitope description:WWSPTMLTQSKE host organism:Mus musculus antibody name:mAb 24/10, a18

    Publication: 16132176;

  11. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505598

    Description: epitope description:SPTFPTLTSSAL host organism:Mus musculus antibody name:mAb a18

    Publication: 16132176;

  12. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505601

    Description: epitope description:YTSPTFPNFFLS host organism:Mus musculus antibody name:mAb a18

    Publication: 16132176;

  13. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505604

    Description: epitope description:EWSPTKLLWFHS host organism:Mus musculus antibody name:mAb a18

    Publication: 16132176;

  14. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505624

    Description: epitope description:DLPRWPGWYKNR host organism:Mus musculus antibody name:mAb 24/16

    Publication: 16132176;

  15. Characterization of epitopes for neutralizing monoclonal antibodies to classical swine fever virus E2 and Erns using phage-displayed random peptide li...

    ID: 1505626

    Description: epitope description:ANSFWVNHPTIT host organism:Mus musculus antibody name:mAb 1B5

    Publication: 16132176;

  16. Murine monoclonal antibodies to PorA of Neisseria meningitidis show reduced protective activity in vivo against B:15:P1.7,16 subtype variants in an in...

    ID: 1505654

    Description: epitope description:TKDTNNNL antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c antibody name:MN12H2

    Publication: 11273739;

  17. Reduced allergenic potency of VR9-1, a mutant of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1505684

    Description: epitope description:DEERM antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 16339577;

  18. Distinct localization of a beta-tubulin epitope in the Tetrahymena thermophila and Paramecium caudatum cortex.

    ID: 1505693

    Description: epitope description:FGQIFRPDNFVFGQS antigen name:Tubulin beta chain host organism:Mus musculus antibody name:TU-06

    Publication: 16228897;

  19. Distinct localization of a beta-tubulin epitope in the Tetrahymena thermophila and Paramecium caudatum cortex.

    ID: 1505695

    Description: epitope description:FGQIFRPDNFVFGQS antigen name:Tubulin beta chain host organism:Mus musculus antibody name:TU-06

    Publication: 16228897;

  20. Distinct localization of a beta-tubulin epitope in the Tetrahymena thermophila and Paramecium caudatum cortex.

    ID: 1505697

    Description: epitope description:FGQIFRPDNFVFGQS antigen name:Tubulin beta chain host organism:Mus musculus antibody name:TU-06

    Publication: 16228897;

  21. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1505717

    Description: epitope description:VAPAADAPQGFYVLENDYSA antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

    Publication: 1659412;

  22. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1505719

    Description: epitope description:FNGAYTPANYANVPWLSRNY antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

    Publication: 1659412;

  23. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1505720

    Description: epitope description:NYTPKNKIERNHKYDIKLTI antigen name:Major fimbrial subunit protein type-1 host organism:Oryctolagus cuniculus

    Publication: 1659412;

  24. Immunobiological activities of synthetic peptide segments of fimbrial protein from Porphyromonas gingivalis.

    ID: 1505813

    Description: epitope description:GEQQEAIKSAENATKVEDIK antigen name:Major fimbrial subunit protein type-1 host organism:Mus musculus BALB/c

    Publication: 1659412;

  25. Efficacy of immune sera from human immunoglobulin transgenic mice immunized with a peptide mimotope of Cryptococcus neoformans glucuronoxylomannan.

    ID: 1505814

    Description: epitope description:GMDGTQLDRW host organism:Mus musculus Xenomouse

    Publication: 15364457;

  26. Efficacy of immune sera from human immunoglobulin transgenic mice immunized with a peptide mimotope of Cryptococcus neoformans glucuronoxylomannan.

    ID: 1505815

    Description: epitope description:GMDGTQLDRW host organism:Mus musculus Xenomouse

    Publication: 15364457;

  27. Mutational analysis of the IgE epitopes in the latex allergen Hev b 5.

    ID: 1505825

    Description: epitope description:QTTPEEKPAEP antigen name:Hev b 5 host organism:Homo sapiens

    Publication: 11398087;

  28. Cross-reactivity studies of an anti-Plasmodium vivax apical membrane antigen 1 monoclonal antibody: binding and structural characterisation.

    ID: 1505859

    Description: epitope description:K385, E386, C390, P391, C392, E393, P394, E395, N408, C409, V410 antigen name:Apical merozoite antigen 1 host organism:Mus musculu...

    Publication: 17229439;

  29. Genetic immunisation with bovine beta-lactoglobulin cDNA induces a preventive and persistent inhibition of specific anti-BLG IgE response in mice.

    ID: 1505903

    Description: epitope description:SLAMAASDISLLDAQSAPLR antigen name:Bos d 5 host organism:Mus musculus BALB/c

    Publication: 11641607;

  30. Immunization with hybrid hepatitis B virus core particles carrying circumsporozoite antigen epitopes protects mice against Plasmodium yoelii challenge...

    ID: 1505910

    Description: epitope description:QGPGAPQGPGAPQGPGAPQGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus BALB/c

    Publication: 9382731;

  31. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506029

    Description: epitope description:VYDYNCHVDL antigen name:Squamous cell carcinoma antigen recognized by T-cells 3 host organism:Homo sapiens

    Publication: 12753654;

  32. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506031

    Description: epitope description:AYIDFEMKI antigen name:Squamous cell carcinoma antigen recognized by T-cells 3 host organism:Homo sapiens

    Publication: 12753654;

  33. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506034

    Description: epitope description:DFMIQGGDF antigen name:Peptidyl-prolyl cis-trans isomerase B host organism:Homo sapiens

    Publication: 12753654;

  34. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506038

    Description: epitope description:DYPSLSATDI antigen name:RNA-binding protein NOB1 host organism:Homo sapiens

    Publication: 12753654;

  35. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506048

    Description: epitope description:KFHRVIKDF antigen name:Peptidyl-prolyl cis-trans isomerase B host organism:Homo sapiens

    Publication: 12753654;

  36. IgG reactive to CTL-directed epitopes of self-antigens is either lacking or unbalanced in atopic dermatitis patients.

    ID: 1506050

    Description: epitope description:DFMIQGGDF antigen name:Peptidyl-prolyl cis-trans isomerase B host organism:Homo sapiens

    Publication: 12753654;

  37. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506097

    Description: epitope description:EGSTDTTSTHTTNTQNNDWF antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  38. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506101

    Description: epitope description:TYGYATAEDFVSGPNTSGLE antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  39. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506102

    Description: epitope description:HLFDWVTSDSFGRCHLLELP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  40. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506103

    Description: epitope description:LELPTDHKGVYGSLTDSYAY antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  41. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506121

    Description: epitope description:VGVNRYDQYKVHKPWTLVVM antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  42. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506124

    Description: epitope description:LAAKHMSNTFLAGLAQYYTQ antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  43. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506127

    Description: epitope description:VAETTNVQGWVCLFQITHGK antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  44. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506129

    Description: epitope description:NTGSIINNYYMQQYQNSMDT antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  45. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506134

    Description: epitope description:TRNGHTTSTTQSSVGVTYGY antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  46. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506135

    Description: epitope description:TYGYATAEDFVSGPNTSGLE antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  47. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506145

    Description: epitope description:LVVMVVAPLTVNTEGAPQIK antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  48. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506155

    Description: epitope description:GPTDAKARYMIAYAPPGMEP antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  49. Detection and characterization of functional T-cell epitopes on the structural proteins VP2, VP3, and VP4 of foot and mouth disease virus O1 campos.

    ID: 1506159

    Description: epitope description:VAETTNVQGWVCLFQITHGK antigen name:Polyprotein host organism:Mus musculus BALB/c

    Publication: 10860876;

  50. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506245

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  51. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506249

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  52. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506251

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  53. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506266

    Description: epitope description:DDPPATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  54. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506269

    Description: epitope description:CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  55. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506270

    Description: epitope description:CQVGSSNSAFVSTSSSRRYTEVYL antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  56. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506271

    Description: epitope description:GALATYQSEYLAHRRIPP antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  57. Location of the Bombyx mori aminopeptidase N type 1 binding site on Bacillus thuringiensis Cry1Aa toxin.

    ID: 1506280

    Description: epitope description:NEVYIDRIEFVPAEVTFEAEYD antigen name:Other Bacillus thuringiensis protein host organism:Mus musculus BALB/c antibody name:1E10

    Publication: 16000811;

  58. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506369

    Description: epitope description:KVSFFCKNKEKKCSY antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  59. The prevalence of coeliac disease antibodies in patients with the antiphospholipid syndrome.

    ID: 1506370

    Description: epitope description:SCKLPVKKATVVYQGERVKIQ antigen name:Beta-2-glycoprotein 1 host organism:Homo sapiens

    Publication: 12765303;

  60. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506371

    Description: epitope description:VHTWTEQYK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.4-A1-C3 AND 1C6.3

    Publication: 18160621;

  61. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506384

    Description: epitope description:TRLENLMWK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:5H4.3

    Publication: 18160621;

  62. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506390

    Description: epitope description:LITVNPI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  63. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506400

    Description: epitope description:VDRGWGNGC antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  64. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506403

    Description: epitope description:PATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  65. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506404

    Description: epitope description:PATVYRYDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  66. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506412

    Description: epitope description:YDSRPPEDV antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  67. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506416

    Description: epitope description:DDPPATVYRYDSRPP antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  68. Structural and functional analysis of the S1 subunit of pertussis toxin using synthetic peptides.

    ID: 1506464

    Description: epitope description:MAAWSERAGEAMVLVYYESIAYSF antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus

    Publication: 2017195;

  69. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506479

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 18160621;

  70. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506485

    Description: epitope description:YSWKTWG antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 18160621;

  71. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506487

    Description: epitope description:TTASGKLIT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  72. Monoclonal antibodies that bind to common epitopes on the dengue virus type 2 nonstructural-1 and envelope glycoproteins display weak neutralizing act...

    ID: 1506489

    Description: epitope description:TTASGKLIT antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1G5.3

    Publication: 18160621;

  73. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506506

    Description: epitope description:WHVLYSP antigen name:Envelope glycoprotein gp62 host organism:Homo sapiens

    Publication: 15223246;

  74. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506525

    Description: epitope description:WHQLYSP host organism:Homo sapiens

    Publication: 15223246;

  75. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506527

    Description: epitope description:WHSMFAP host organism:Homo sapiens

    Publication: 15223246;

  76. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506541

    Description: epitope description:WHRLLAI host organism:Homo sapiens

    Publication: 15223246;

  77. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506547

    Description: epitope description:PHMNNFHL host organism:Homo sapiens

    Publication: 15223246;

  78. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506557

    Description: epitope description:PHMQLHHL host organism:Homo sapiens

    Publication: 15223246;

  79. Epitope analysis of the cerebrospinal fluid IgG in HTLV-I associated myelopathy patients using phage display method.

    ID: 1506560

    Description: epitope description:PQSNLAKT host organism:Homo sapiens

    Publication: 15223246;

  80. Monovalent fusion proteins of IgE mimotopes are safe for therapy of type I allergy.

    ID: 1506671

    Description: epitope description:CQQTLSVRALC host organism:Mus musculus BALB/c

    Publication: 11641259;

  81. Monovalent fusion proteins of IgE mimotopes are safe for therapy of type I allergy.

    ID: 1506673

    Description: epitope description:CQQTLSVRALC host organism:Homo sapiens

    Publication: 11641259;

  82. Screening of horse polyclonal antibodies with a random peptide library displayed on phage: identification of ligands used as antigens in an ELISA test...

    ID: 1506745

    Description: epitope description:PMWPME host organism:Equus caballus

    Publication: 9766888;

  83. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500430

    Description: epitope description:ELQGDRRCQSQLERA antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  84. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500558

    Description: epitope description:NNQRCMCEALQQIME antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  85. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500562

    Description: epitope description:QRCMCEALQQIMENQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  86. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500568

    Description: epitope description:CEALQQIMENQSDRL antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  87. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500572

    Description: epitope description:ALQQIMENQSDRLQG antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  88. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500583

    Description: epitope description:QSDRLQGRQQEQQFK antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  89. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500585

    Description: epitope description:QSDRLQGRQQEQQFK antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  90. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500596

    Description: epitope description:QQEQQFKRELRNLPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  91. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500597

    Description: epitope description:QQEQQFKRELRNLPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  92. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500599

    Description: epitope description:EQQFKRELRNLPQQC antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  93. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500608

    Description: epitope description:ELRNLPQQCGLRAPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  94. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500609

    Description: epitope description:ELRNLPQQCGLRAPQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  95. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500612

    Description: epitope description:AEGCVGRVCDSRAMAVM host organism:Mus musculus BALB/c antibody name:5B170, 5B19

    Publication: 10814583;

  96. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500616

    Description: epitope description:RNLPQQCGLRAPQRC antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  97. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500618

    Description: epitope description:DRRCQSQLERANLRP antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  98. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500625

    Description: epitope description:MRLQVSPETLFWMECS host organism:Mus musculus BALB/c antibody name:7-10A

    Publication: 10814583;

  99. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500629

    Description: epitope description:SASRSCIGSQCSTTA host organism:Mus musculus C57BL/6

    Publication: 10814583;

  100. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500633

    Description: epitope description:GCIGSYCV host organism:Mus musculus C57BL/6

    Publication: 10814583;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston