Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471503

    Description: epitope description:PNLSAYPKSHGKTAK antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  2. Mapping of linear epitopes on fibre knob of human adenovirus serotype 5.

    ID: 1471508

    Description: epitope description:AYSMSFSWDWSGHNY antigen name:Fiber protein host organism:Oryctolagus cuniculus antibody name:rabbit antisera

    Publication: 11172918;

  3. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471618

    Description: epitope description:DQVDVKDCANHEIKK antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  4. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471643

    Description: epitope description:GQQYDIKYTWNVPK antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  5. T cell epitopes of house dust mite major allergen Der p II.

    ID: 1471649

    Description: epitope description:SENVVVTVKVMGDD antigen name:Der p 2 host organism:Homo sapiens antibody name:patient sera

    Publication: 7688399;

  6. Distinct human T cell repertoires mediate immediate and delayed-type hypersensitivity to the Trichophyton antigen, Tri r 2.

    ID: 1471667

    Description: epitope description:DCNGHGTHVAGTVGGTKYGL antigen name:Subtilisin-like protease 6 host organism:Homo sapiens

    Publication: 11035075;

  7. Improvement of binding of Puumala virus neutralization site resembling peptide with a second-generation phage library.

    ID: 1471720

    Description: epitope description:FPCDRLSGYWERGIPSPCVR host organism:Homo sapiens antibody name:mAb 1C9

    Publication: 12874378;

  8. Improvement of binding of Puumala virus neutralization site resembling peptide with a second-generation phage library.

    ID: 1471722

    Description: epitope description:FPCDRLSGYWERGIPSPCVR host organism:Homo sapiens antibody name:mAb 1C9

    Publication: 12874378;

  9. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471843

    Description: epitope description:EAESISSSEEIVPNSVE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  10. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471847

    Description: epitope description:YLGYLEQLLRLKKYKVPQLE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  11. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471850

    Description: epitope description:VPQLEIVPNSAEERLHSMKE antigen name:Bos d 9 host organism:Oryctolagus cuniculus

    Publication: 15541041;

  12. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471860

    Description: epitope description:YVPLGTQYTDAPSFSDIPN antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 15541041;

  13. Evaluation of the allergenicity and antigenicity of bovine-milk alphas1-casein using extensively purified synthetic peptides.

    ID: 1471861

    Description: epitope description:YVPLGTQYTDAPSFSDIPN antigen name:Bos d 9 host organism:Oryctolagus cuniculus

    Publication: 15541041;

  14. IgE-mediated rat mast cell triggering with tryptic and synthetic peptides of bovine beta-lactoglobulin.

    ID: 1471871

    Description: epitope description:IDALNENK antigen name:Bos d 5 host organism:Rattus norvegicus

    Publication: 16220005;

  15. IgE-mediated rat mast cell triggering with tryptic and synthetic peptides of bovine beta-lactoglobulin.

    ID: 1471872

    Description: epitope description:VLVLDTDYK antigen name:Bos d 5 host organism:Rattus norvegicus

    Publication: 16220005;

  16. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472048

    Description: epitope description:MPIQAFLLYQEP antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 17517096;

  17. Mutational analysis of immunoglobulin E-binding epitopes of beta-casein and beta-lactoglobulin showed a heterogeneous pattern of critical amino acids ...

    ID: 1472094

    Description: epitope description:AQKKIIAEKTKI antigen name:Bos d 5 host organism:Homo sapiens

    Publication: 17517096;

  18. Multi-epitope schistosome vaccine candidates tested for protective immunogenicity in mice.

    ID: 1472105

    Description: epitope description:MMNHDTESHVKISRTIYRGVSPSTT antigen name:Putative paramyosin host organism:Mus musculus CBA antibody name:mouse serum

    Publication: 10924792;

  19. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472115

    Description: epitope description:CWAFSGVAATESAYLAHRNQSLDLAEQELVDCASQHGCHGDTIPRGI antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;

  20. IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

    ID: 1472117

    Description: epitope description:LAHRNQSLDLAEQELVDCASQHGCH antigen name:Der p 1 host organism:Homo sapiens antibody name:patient sera

    Publication: 1940366;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston