T cell recognition of hypervariable region-1 from hepatitis C virus envelope protein with multiple class II MHC molecules in mice and humans: preferen...

ID: 1327043

Description: epitope description:GSTAHNARTLTGMFSLGARQK antigen name:Genome polyprotein host organism:Homo sapiens antibody name:Human sera

Conserved group-specific epitopes of the circumsporozoite proteins revealed by antibodies to synthetic peptides.

ID: 1335388

Description: epitope description:RRKAHAGNKKAEDLTMDDLE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus New Zealand White antibody nam...

Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

ID: 1335418

Description: epitope description:NEREDERTLTKEYEDIVLK antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus New Zealand White

Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

ID: 1335419

Description: epitope description:NEREDERTLTKEYEDIVLK antigen name:Erythrocyte binding antigen 175 host organism:Oryctolagus cuniculus New Zealand White

Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

ID: 1335420

Description: epitope description:RNNHPQNTSDSQKEATDGNK host organism:Oryctolagus cuniculus New Zealand White

Model multiple antigenic and homopolymeric peptides from non-repetitive sequences of malaria merozoite proteins elicit biologically irrelevant antibod...

ID: 1335421

Description: epitope description:RNNHPQNTSDSQKEATDGNK host organism:Oryctolagus cuniculus New Zealand White

Multiple non-repeated epitopes on the circumsporozoite protein of Plasmodium knowlesi.

ID: 1335424

Description: epitope description:PKKPNENKLKQPNE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:rabbit anti-N2

Multiple non-repeated epitopes on the circumsporozoite protein of Plasmodium knowlesi.

ID: 1335426

Description: epitope description:RRKAHAGNKKAEDLTMDDLE antigen name:Circumsporozoite (CS) protein host organism:Oryctolagus cuniculus antibody name:anti-sporozoite

Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

ID: 1335481

Description: epitope description:DVPYVKRVKTWRMH antigen name:Band 3 anion transport protein host organism:Homo sapiens

Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

ID: 1335486

Description: epitope description:YDSLKEKLQKTYSQY antigen name:DNAJ protein, putative host organism:Homo sapiens

Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

ID: 1335490

Description: epitope description:KEKLQKTYSQ antigen name:DNAJ protein, putative host organism:Homo sapiens

Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

ID: 1335492

Description: epitope description:EENVEENV antigen name:DNAJ protein, putative host organism:Homo sapiens

Antibodies to a non-repeat region of Plasmodium falciparum antigen Pf155/RESA in individuals from malaria-endemic areas.

ID: 1335495

Description: epitope description:INKRKYDSLKEKL antigen name:DNAJ protein, putative host organism:Homo sapiens

Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

ID: 1335517

Description: epitope description:KQEGDKCVENPNPTCNENN antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

ID: 1335527

Description: epitope description:GCDADATCTEEDSGSSRKK antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

ID: 1335532

Description: epitope description:TCECTKPDSYPLFDGIFCS antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Identification of T and B cell epitopes recognized by humans in the C-terminal 42-kDa domain of the Plasmodium falciparum merozoite surface protein (M...

ID: 1335534

Description: epitope description:PLFDGIFCSSSNFLGISFL antigen name:Merozoite surface protein 1 host organism:Homo sapiens

Isotypic analysis of Plasmodium falciparum-specific antibodies and their relation to protection in Madagascar.

ID: 1335619

Description: epitope description:DDEHVEEPTVA antigen name:DNAJ protein, putative host organism:Homo sapiens

Monoclonal antibodies that inhibit Plasmodium falciparum invasion in vitro recognise the first growth factor-like domain of merozoite surface protein-...

ID: 1335653

Description: epitope description:NISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT antigen name:Merozoite surface protein 1 host organism:Mus musculus antibody name...

Pan DR binding sequence provides T-cell help for induction of protective antibodies against Plasmodium yoelii sporozoites.

ID: 1335763

Description: epitope description:QGPGAP antigen name:Circumsporozoite protein (UniProt:Q7RJT9) host organism:Mus musculus