Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823833

    Description: epitope description:beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->6)-D-Gal antigen name:glycolipid host organism:Homo sapiens

    Publication: 6208947;

  2. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823848

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-...

    Publication: 6208947;

  3. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823851

    Description: epitope description:beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-[beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->6)]-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-...

    Publication: 6208947;

  4. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823864

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus BALB/c

    Publication: 6208947;

  5. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823881

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  6. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823882

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  7. Species differences in the expression of carbohydrate differentiation antigens on mammalian blood cells revealed by immunofluorescence with monoclonal...

    ID: 1823886

    Description: epitope description:alpha-Neup5Ac-(2->3)-beta-D-Galp-(1->4)-beta-D-GlcpNAc-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc antigen name:glycolipid host organism:H...

    Publication: 6208947;

  8. A-active trisaccharides isolated from A1 and A2 blood-group-specific glycoproteins.

    ID: 1823928

    Description: epitope description:alpha-D-GalpNAc-(1->3)-beta-D-Galp-(1->3)-D-GalNAc-ol antigen name:glycoprotein host organism:Homo sapiens

    Publication: 6172274;

  9. Identification of CD4+ T cell epitopes in C. burnetii antigens targeted by antibody responses.

    ID: 1824104

    Description: epitope description:DLRYHAPIYGAVHPR antigen name:Hypothetical exported protein (UniProt:Q83CG1) host organism:Mus musculus C57BL/6

    Publication: 21423609;

  10. Identification of CD4+ T cell epitopes in C. burnetii antigens targeted by antibody responses.

    ID: 1824105

    Description: epitope description:VHHYLVNHPEVLVEA antigen name:Outer membrane protein (UniProt:H7C7D7) host organism:Mus musculus C57BL/6

    Publication: 21423609;

  11. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824112

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 1383424;

  12. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824119

    Description: epitope description:beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 1383424;

  13. Isolated bovine spinal motoneurons have specific ganglioside antigens recognized by sera from patients with motor neuron disease and motor neuropathy.

    ID: 1824120

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Gc-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 1383424;

  14. The alpha-L-(1----2)-trirhamnopyranoside epitope on the group-specific polysaccharide of group B streptococci.

    ID: 1824257

    Description: epitope description:alpha-L-rhamnopyranose antigen name:polysaccharide host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1708356;

  15. Antibodies to HLA-E in nonalloimmunized males: pattern of HLA-Ia reactivity of anti-HLA-E-positive sera.

    ID: 1824290

    Description: epitope description:DTAAQI antigen name:HLA class I histocompatibility antigen, alpha chain E host organism:Homo sapiens

    Publication: 20610644;

  16. Antibodies to HLA-E in nonalloimmunized males: pattern of HLA-Ia reactivity of anti-HLA-E-positive sera.

    ID: 1824297

    Description: epitope description:A138, Y139, D140, G141, K142, D143, Y144, D158, T159, A160, A161, Q162, I163, S164 antigen name:HLA class I histocompatibility ant...

    Publication: 20610644;

  17. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816238

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 10751257;

  18. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816244

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  19. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816247

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  20. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816249

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 10751257;

  21. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816255

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 10751257;

  22. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816260

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 10751257;

  23. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816261

    Description: epitope description:ganglioside GM2 host organism:Homo sapiens

    Publication: 10751257;

  24. Cross-reactive antibodies against GM2 and CMV-infected fibroblasts in Guillain-Barré syndrome.

    ID: 1816265

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 10751257;

  25. Further evidence that carbohydrates are the immunodeterminant structures of blood group M and N specificities.

    ID: 1816285

    Description: epitope description:beta-D-galactose host organism:Equus caballus

    Publication: 6169631;

  26. Design and characterization of highly immunogenic heat-stable enterotoxin of enterotoxigenic Escherichia coli K99(+).

    ID: 1816295

    Description: epitope description:NTFYCCELCCNPACAGCY antigen name:Heat-stable enterotoxin ST-IA/ST-P host organism:Oryctolagus cuniculus

    Publication: 21277302;

  27. Serodiagnosis of porcine reproductive and respiratory syndrome virus infection with the use of glycoprotein 5 antigens.

    ID: 1816320

    Description: epitope description:VIIEKRGKVEVEGHLID antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20885848;

  28. Serodiagnosis of porcine reproductive and respiratory syndrome virus infection with the use of glycoprotein 5 antigens.

    ID: 1816328

    Description: epitope description:SHLQLIYNLTLCELNGTDW antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 20885848;

  29. Epitope mapping of HLA-B27 and HLA-B7 antigens by using intradomain recombinants.

    ID: 1816347

    Description: epitope description:D101, T104 antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Mus musculus C57BL/6 X BALB/c antib...

    Publication: 2459214;

  30. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816352

    Description: epitope description:VDMRGDCWSIEY antigen name:Cysteine protease S273R host organism:Mus musculus BALB/c

    Publication: 21468582;

  31. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816360

    Description: epitope description:VQKKYGGGEDCECTRV antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  32. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816361

    Description: epitope description:INELKKEHTDKIQIVSKL antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  33. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816363

    Description: epitope description:MSRIFRGDNALNMGRPKFLSDQIFNKV antigen name:Polyprotein pp220 host organism:Mus musculus BALB/c

    Publication: 21468582;

  34. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816370

    Description: epitope description:LKEDSRDRT antigen name:Structural protein p14.5 host organism:Mus musculus BALB/c

    Publication: 21468582;

  35. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816376

    Description: epitope description:FEEETESSASSES antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  36. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816377

    Description: epitope description:FEQEPSSEEPKDSKL antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  37. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816378

    Description: epitope description:LKEEEKEVVRLMVIKLLKKNKL antigen name:Phosphoprotein p30 host organism:Mus musculus BALB/c

    Publication: 21468582;

  38. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816384

    Description: epitope description:LCNIHDLHKPHQSKPILTDENDTQRTCS antigen name:Major capsid protein host organism:Mus musculus BALB/c

    Publication: 21468582;

  39. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816389

    Description: epitope description:SEPELDMDLIEMEKSISEERLKN antigen name:Uncharacterized protein E301R host organism:Mus musculus BALB/c

    Publication: 21468582;

  40. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816390

    Description: epitope description:FEEDKKMLELFVQKL antigen name:Protein H339R host organism:Mus musculus BALB/c

    Publication: 21468582;

  41. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816411

    Description: epitope description:YCEYPGERLYENVRFDVNGNSLDEYSSDVTTL antigen name:Major capsid protein host organism:Sus scrofa

    Publication: 21468582;

  42. Vaccination with viral protein-mimicking peptides postpones mortality in domestic pigs infected by African swine fever virus.

    ID: 1816413

    Description: epitope description:QKDLVNEFPGLFIRQSRFIPGRPSRRNIRFKP antigen name:Major capsid protein host organism:Sus scrofa

    Publication: 21468582;

  43. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816417

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9119976;

  44. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816419

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-[beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)]-beta-D-galactosyl-(1->4)-beta-D...

    Publication: 9119976;

  45. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816421

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  46. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816425

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  47. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816428

    Description: epitope description:alpha-Neu5Ac-(2->3)-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  48. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816430

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  49. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816432

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;

  50. Close association of Guillain-Barré syndrome with antibodies to minor monosialogangliosides GM1b and GM1 alpha.

    ID: 1816435

    Description: epitope description:beta-D-Gal-(1->3)-[alpha-Neu5Ac-(2->6)]-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 9119976;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston