Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816988

    Description: epitope description:EGPPPKDT antigen name:Small nuclear ribonucleoprotein-associated protein N host organism:Homo sapiens

    Publication: 21362751;

  2. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816994

    Description: epitope description:CETNTGEV antigen name:Small nuclear ribonucleoprotein Sm D3 host organism:Homo sapiens

    Publication: 21362751;

  3. Epitope mapping of the U1 small nuclear ribonucleoprotein particle in patients with systemic lupus erythematosus and mixed connective tissue disease.

    ID: 1816998

    Description: epitope description:EEEEDGEM antigen name:Small nuclear ribonucleoprotein F host organism:Homo sapiens

    Publication: 21362751;

  4. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821171

    Description: epitope description:TVEGVKALIDEI antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  5. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821179

    Description: epitope description:PKTDTYKLILNG antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  6. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821184

    Description: epitope description:NGKTLKGETTTE antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  7. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821188

    Description: epitope description:TTTEAVDAATAR antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  8. Identification of B- and T-cell epitopes of BB, a carrier protein derived from the G protein of Streptococcus strain G148.

    ID: 1821189

    Description: epitope description:TEAVDAATARSF antigen name:Immunoglobulin G-binding protein G host organism:Mus musculus BALB/c

    Publication: 12522050;

  9. Removal of xenoreactive human anti-pig antibodies by absorption on recombinant mucin-containing glycoproteins carrying the Gal alpha1,3Gal epitope.

    ID: 1821200

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 9197365;

  10. Removal of xenoreactive human anti-pig antibodies by absorption on recombinant mucin-containing glycoproteins carrying the Gal alpha1,3Gal epitope.

    ID: 1821201

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Homo sapiens

    Publication: 9197365;

  11. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821211

    Description: epitope description:FPEVFGKEKVNELSKDIGSE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  12. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821213

    Description: epitope description:VEQKHIQKEDVPSERYLGYL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  13. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821219

    Description: epitope description:VPQLEIVPNSAEERLHSMKE antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 21211944;

  14. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821223

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca fascicularis

    Publication: 12488437;

  15. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821225

    Description: epitope description:YPYYAKPAAVRSPAQILQWQ antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  16. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821229

    Description: epitope description:YAKPAAVRSPAQILQWQVLS antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  17. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821238

    Description: epitope description:PAQILQWQVLSNTVPAKSCQ antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  18. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821244

    Description: epitope description:AKSCQAQPTTMARHPHPHLS antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  19. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821253

    Description: epitope description:PPKKNQDKTEIPTINTIASG antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  20. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821254

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca fascicularis

    Publication: 12488437;

  21. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821257

    Description: epitope description:TINTIASGEPTSTPTTEAVE antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  22. Dietary antigens, epitope recognition, and immune complex formation in recent onset psychosis and long-term schizophrenia.

    ID: 1821260

    Description: epitope description:TIASGEPTSTPTTEAVESTV antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 21211944;

  23. Removal of anti-Galalpha1,3Gal xenoantibodies with an injectable polymer.

    ID: 1821270

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Macaca mulatta

    Publication: 12488437;

  24. Use of molecular modeling and site-directed mutagenesis to define the structural basis for the immune response to carbohydrate xenoantigens.

    ID: 1821285

    Description: epitope description:alpha-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-D-Glc host organism:Homo sapiens

    Publication: 17352819;

  25. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821298

    Description: epitope description:myo-inositol antigen name:Variant surface glycoprotein (VSG, atypical), putative (UniProt:Q57XH3) host organism:Oryctolagus cunicu...

    Publication: 2450138;

  26. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821301

    Description: epitope description:alpha-D-glucose 1-phosphate host organism:Oryctolagus cuniculus

    Publication: 2450138;

  27. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821303

    Description: epitope description:glycerol 1-phosphate host organism:Oryctolagus cuniculus

    Publication: 2450138;

  28. Partial characterization of the cross-reacting determinant, a carbohydrate epitope shared by decay accelerating factor and the variant surface glycopr...

    ID: 1821307

    Description: epitope description:alpha-D-glucose host organism:Oryctolagus cuniculus

    Publication: 2450138;

  29. Anti-carbohydrate antibodies associated with hyperacute rejection in a vascularized mouse heart-to-rat xenotransplantation model.

    ID: 1821311

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 8623166;

  30. Are autoantibodies against Lewis antigens involved in the pathogenesis of Helicobacter pylori-induced peptic ulcers?

    ID: 1821316

    Description: epitope description:alpha-L-Fucp-(1->2)-beta-D-Galp-(1->4)-[alpha-L-Fucp-(1->3)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musc...

    Publication: 10449246;

  31. Molecular mimicry between GQ1b ganglioside and lipopolysaccharides of Campylobacter jejuni isolated from patients with Fisher's syndrome.

    ID: 1821343

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 7526777;

  32. Antistreptococcal group A antibodies: production after in vitro activation and hybridization of mouse spleen cells.

    ID: 1821354

    Description: epitope description:N-acetyl-D-glucosamine antigen name:polysaccharide host organism:Mus musculus BALB/c antibody name:20S7.1

    Publication: 7020569;

  33. Synthetic peptides homologous to human glycophorins of the Miltenberger complex of variants of MNSs blood group system specify the epitopes for Hil, S...

    ID: 1821368

    Description: epitope description:EISVTTVYPP antigen name:Other Homo sapiens (human) protein host organism:Homo sapiens

    Publication: 1718498;

  34. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821403

    Description: epitope description:EEIEKE antigen name:Membrane transport protein XK host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  35. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821439

    Description: epitope description:EEIEKE antigen name:Membrane transport protein XK host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  36. A murine monoclonal antibody against Kx protein which reacts also with beta-spectrin.

    ID: 1821455

    Description: epitope description:LAQELEKE antigen name:Spectrin beta chain, erythrocytic host organism:Mus musculus BALB/c antibody name:3A12

    Publication: 10849386;

  37. Characterization of porcine kidney neutral glycosphingolipids: identification of a carbohydrate antigen recognized by human natural antibodies.

    ID: 1821479

    Description: epitope description:alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Rattus norvegicus Lewis antibody name:38....

    Publication: 7841803;

  38. High-dose porcine hematopoietic cell transplantation combined with CD40 ligand blockade in baboons prevents an induced anti-pig humoral response.

    ID: 1821487

    Description: epitope description:alpha-D-Galp-(1->3)-beta-D-Galp-(1->4)-D-GlcpNAc-yl group host organism:Papio anubis

    Publication: 10868629;

  39. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821622

    Description: epitope description:NKYRGTAGNALMDGASQL + CITR(R4) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  40. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821623

    Description: epitope description:NKYRGTAGNALMDGASQL + PALM(N1) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  41. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821632

    Description: epitope description:KYQISVNKYRGTAGNALMDGASQLMGENRT + CITR(R29) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  42. Antibodies against beta-fibrin synthetic peptides: a study of their association with the immunogenetic background and disease course of rheumatoid art...

    ID: 1821633

    Description: epitope description:KYQISVNKYRGTAGNALMDGASQLMGENRT + CITR(R10, R29) antigen name:Fibrinogen beta chain host organism:Homo sapiens

    Publication: 21295379;

  43. Carbohydrate residues downstream of the terminal Galalpha(1,3)Gal epitope modulate the specificity of xenoreactive antibodies.

    ID: 1821638

    Description: epitope description:methyl alpha-D-galactoside host organism:Mus musculus alpha-galactosyl transferase null antibody name:15.101

    Publication: 17724458;

  44. Carbohydrate residues downstream of the terminal Galalpha(1,3)Gal epitope modulate the specificity of xenoreactive antibodies.

    ID: 1821639

    Description: epitope description:methyl alpha-D-galactoside host organism:Mus musculus alpha-galactosyl transferase null antibody name:16.34

    Publication: 17724458;

  45. A novel pentaglycosylceramide in ostrich liver, IV4-beta-Gal-nLc4Cer, with terminal Gal(beta1-4)Gal, a xenoepitope recognized by human natural antibod...

    ID: 1821649

    Description: epitope description:alpha-D-galactosyl-(1->3)-D-galactose host organism:Homo sapiens

    Publication: 10988247;

  46. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821689

    Description: epitope description:EPTDTPVSHDDTIVVTAAEQNLQ antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:29

    Publication: 2139651;

  47. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821710

    Description: epitope description:QALTGTNTGGAIDGVSTTD antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:24, 23

    Publication: 2139651;

  48. Analysis of the repertoire of human B-lymphocytes specific for type A and type B blood group terminal trisaccharide epitopes.

    ID: 1821756

    Description: epitope description:alpha-D-Gal-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal host organism:Homo sapiens

    Publication: 7679803;

  49. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821927

    Description: epitope description:DINQGHQSARAGTYATTLPAGREG antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:33

    Publication: 2139651;

  50. Surface topology of the Escherichia coli K-12 ferric enterobactin receptor.

    ID: 1821929

    Description: epitope description:QALTGTNTGGAIDGVSTTD antigen name:Ferrienterobactin receptor host organism:Mus musculus BALB/c antibody name:23, 24

    Publication: 2139651;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston