Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504608

    Description: epitope description:QPRDANGFAATL host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  2. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504613

    Description: epitope description:TMRDSNGFFIEP host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  3. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504618

    Description: epitope description:QHLLSPNVRPPH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  4. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504619

    Description: epitope description:FHTNSNVRYSHL host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  5. A peptide of foot-and-mouth disease virus serotype Asia1 generating a neutralizing antibody response, and an immunostimulatory peptide.

    ID: 1504625

    Description: epitope description:KTTYGEESTSRGDPSALAQRLSGRLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 17656048;

  6. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504639

    Description: epitope description:SWNASWLSHSYD host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  7. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504642

    Description: epitope description:CPPHPNLRGICR host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  8. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504654

    Description: epitope description:EFSIKPKTSVTP host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  9. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504670

    Description: epitope description:FAPWHVKRMLHH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  10. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504674

    Description: epitope description:SHYNHSTHPPRH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston