Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500641

    Description: epitope description:ASTTNCIGSQCLMTN host organism:Mus musculus C57BL/6

    Publication: 10814583;

  2. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500643

    Description: epitope description:DPARDCVHNICIFAG host organism:Mus musculus C57BL/6

    Publication: 10814583;

  3. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500644

    Description: epitope description:DPARDCVHNICIFAG host organism:Mus musculus C57BL/6

    Publication: 10814583;

  4. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500654

    Description: epitope description:TDRLDRCLPAISTDPCF host organism:Mus musculus C57BL/6

    Publication: 10814583;

  5. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500658

    Description: epitope description:SASRSCIGSQCSTTA host organism:Mus musculus BALB/c

    Publication: 10814583;

  6. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500659

    Description: epitope description:SASRSCIGSQCSTTA host organism:Mus musculus BALB/c

    Publication: 10814583;

  7. Characterization of murine coronavirus neutralization epitopes with phage-displayed peptides.

    ID: 1500664

    Description: epitope description:SASRSCIGSQCSTTA host organism:Mus musculus C57BL/6

    Publication: 10814583;

  8. Lys89, Lys90, and Phe91 are critical core amino acid residues of the Pen ch 18 major fungal allergen recognized by human IgE antibodies.

    ID: 1500683

    Description: epitope description:SGTIAGKKF antigen name:Pen ch 18 host organism:Homo sapiens

    Publication: 18760997;

  9. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500432

    Description: epitope description:QGDRRCQSQLERANL antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  10. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500435

    Description: epitope description:DRRCQSQLERANLRP antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  11. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500436

    Description: epitope description:DRRCQSQLERANLRP antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  12. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500437

    Description: epitope description:DRRCQSQLERANLRP antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  13. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500444

    Description: epitope description:QLERANLRPCEQHLM antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  14. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500446

    Description: epitope description:QLERANLRPCEQHLM antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  15. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500449

    Description: epitope description:ERANLRPCEQHLMQK antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  16. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500450

    Description: epitope description:ANLRPCEQHLMQKIQ antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  17. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500451

    Description: epitope description:ANLRPCEQHLMQKIQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  18. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500452

    Description: epitope description:ANLRPCEQHLMQKIQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  19. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500456

    Description: epitope description:PCEQHLMQKIQRDED antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  20. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500460

    Description: epitope description:EQHLMQKIQRDEDSY antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  21. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500475

    Description: epitope description:DEDSYGRDPYSPSQD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  22. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500476

    Description: epitope description:DEDSYGRDPYSPSQD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  23. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500483

    Description: epitope description:RDPYSPSQDPYSPSQ antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  24. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500491

    Description: epitope description:SPSQDPYSPSQDPDR antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  25. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500503

    Description: epitope description:PSQDPDRRDPYSPSP antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  26. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500504

    Description: epitope description:QDPDRRDPYSPSPYD antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  27. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500505

    Description: epitope description:QDPDRRDPYSPSPYD antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  28. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500520

    Description: epitope description:PSPYDRRGAGSSQHQ antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  29. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500522

    Description: epitope description:PYDRRGAGSSQHQER antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  30. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500539

    Description: epitope description:QHQERCCNELNEFEN antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  31. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500547

    Description: epitope description:CNELNEFENNQRCMC antigen name:Ara h 2 host organism:Oryctolagus cuniculus Chinchilla

    Publication: 15508180;

  32. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500549

    Description: epitope description:ELNEFENNQRCMCEA antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  33. Development of an epitope-specific analytical tool for the major peanut allergen Ara h 2 using a high-density multiple-antigenic peptide strategy.

    ID: 1500552

    Description: epitope description:NEFENNQRCMCEALQ antigen name:Ara h 2 host organism:Homo sapiens

    Publication: 15508180;

  34. Chimeric hepatitis B virus core particles carrying an epitope of anthrax protective antigen induce protective immunity against Bacillus anthracis.

    ID: 1500684

    Description: epitope description:EVHGNAEVHASFFDIGGSVSAGFS antigen name:Protective antigen host organism:Cavia porcellus

    Publication: 18786589;

  35. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500725

    Description: epitope description:TATTQGQKVT antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  36. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500731

    Description: epitope description:QKVTLKWDAP antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  37. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500733

    Description: epitope description:VTLKWDAPST antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  38. Identification of two novel B cell epitopes on porcine epidemic diarrhea virus spike protein.

    ID: 1500741

    Description: epitope description:LQDGQVKI antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:3G3, 6E6 and 3G5

    Publication: 18400422;

  39. Monoclonal antibody against Porphyromonas gingivalis hemagglutinin inhibits hemolytic activity.

    ID: 1500744

    Description: epitope description:SNEFAPVQNLTGSSVG antigen name:Other Porphyromonas gingivalis protein host organism:Mus musculus BALB/c antibody name:Pg-vc

    Publication: 11347654;

  40. Protection against syphilis correlates with specificity of antibodies to the variable regions of Treponema pallidum repeat protein K.

    ID: 1500756

    Description: epitope description:QVSFTPDIEGYAELAWGIAS antigen name:UniProt:H6MQ37 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14500480;

  41. Roles of adjuvant and route of vaccination in antibody response and protection engendered by a synthetic matrix protein 2-based influenza A virus vacc...

    ID: 1500758

    Description: epitope description:SLLTEVETPIRNEWGSRSNDSSDP host organism:Mus musculus BALB/c

    Publication: 17974006;

  42. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500765

    Description: epitope description:YTYTVYRD antigen name:Other Porphyromonas gingivalis protein host organism:Mus musculus BALB/c

    Publication: 16148146;

  43. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500767

    Description: epitope description:YTVYRDGT antigen name:Other Porphyromonas gingivalis protein host organism:Mus musculus BALB/c

    Publication: 16148146;

  44. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1500768

    Description: epitope description:TVYRDGTK antigen name:Other Porphyromonas gingivalis protein host organism:Mus musculus BALB/c

    Publication: 16148146;

  45. Identification of previously unknown antigenic epitopes on the S and N proteins of avian infectious bronchitis virus.

    ID: 1500789

    Description: epitope description:ITYKVMREVRALAYFVNGTA antigen name:Spike glycoprotein host organism:Gallus gallus

    Publication: 15868095;

  46. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500832

    Description: epitope description:PAKAAFDSLQASATE antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:anti fd

    Publication: 10329123;

  47. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500844

    Description: epitope description:IGYAWAMVVVIVGAT antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:anti fd

    Publication: 10329123;

  48. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500846

    Description: epitope description:WAMVVVIVGATIGIK antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:anti fd

    Publication: 10329123;

  49. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500866

    Description: epitope description:KLFKKFTSKAS antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:anti fd

    Publication: 10329123;

  50. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1500885

    Description: epitope description:ASRGTSMDDEAD antigen name:Nucleoprotein host organism:Bos taurus antibody name:Immune sera

    Publication: 17374767;

  51. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1500891

    Description: epitope description:MDDEADRYFTYE antigen name:Nucleoprotein host organism:Bos taurus antibody name:Immune sera

    Publication: 17374767;

  52. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1500897

    Description: epitope description:RYFTYEEPNDGE antigen name:Nucleoprotein host organism:Bos taurus antibody name:Immune sera

    Publication: 17374767;

  53. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1500898

    Description: epitope description:YFTYEEPNDGEE antigen name:Nucleoprotein host organism:Bos taurus antibody name:Immune sera

    Publication: 17374767;

  54. Mapping and structural analysis of B-cell epitopes on the morbillivirus nucleoprotein amino terminus.

    ID: 1500899

    Description: epitope description:FTYEEPNDGEER antigen name:Nucleoprotein host organism:Bos taurus antibody name:Immune sera

    Publication: 17374767;

  55. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500919

    Description: epitope description:DPAKAAFD antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:B62-FE2

    Publication: 10329123;

  56. Epitope structures recognised by antibodies against the major coat protein (g8p) of filamentous bacteriophage fd (Inoviridae).

    ID: 1500920

    Description: epitope description:AEGDDPAKA antigen name:Capsid protein G8P host organism:Mus musculus BALB/c antibody name:B62-FE2

    Publication: 10329123;

  57. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500963

    Description: epitope description:EGYPADSKGCKITCF antigen name:Toxin Ts4 host organism:Mus musculus BALB/c

    Publication: 15501287;

  58. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500969

    Description: epitope description:ADSKGCKITCFLTAA antigen name:Toxin Ts4 host organism:Mus musculus BALB/c

    Publication: 15501287;

  59. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500975

    Description: epitope description:GCKITCFLTAAGYCN antigen name:Toxin Ts4 host organism:Mus musculus BALB/c

    Publication: 15501287;

  60. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500976

    Description: epitope description:GCKITCFLTAAGYCN antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15501287;

  61. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500978

    Description: epitope description:KITCFLTAAGYCNTE antigen name:Toxin Ts4 host organism:Mus musculus BALB/c

    Publication: 15501287;

  62. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500980

    Description: epitope description:KITCFLTAAGYCNTE antigen name:Toxin Ts4 host organism:Ovis aries

    Publication: 15501287;

  63. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500985

    Description: epitope description:FLTAAGYCNTECTLK antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15501287;

  64. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1500988

    Description: epitope description:TAAGYCNTECTLKKG antigen name:Toxin Ts4 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 15501287;

  65. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1501001

    Description: epitope description:ECTLKKGSSGYCAWP antigen name:Toxin Ts4 host organism:Ovis aries

    Publication: 15501287;

  66. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1501006

    Description: epitope description:TLKKGSSGYCAWPAC antigen name:Toxin Ts4 host organism:Ovis aries

    Publication: 15501287;

  67. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1501008

    Description: epitope description:KKGSSGYCAWPACYC antigen name:Toxin Ts4 host organism:Mus musculus BALB/c

    Publication: 15501287;

  68. Epitope mapping of the antigenic protein TsNTxP from Tityus serrulatus scorpion venom using mouse, rabbit and sheep antibodies.

    ID: 1501013

    Description: epitope description:KKGSSGYCAWPACYC antigen name:Toxin Ts4 host organism:Ovis aries

    Publication: 15501287;

  69. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504602

    Description: epitope description:TRDAHGFVQSSL host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  70. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504603

    Description: epitope description:VRDAMGFPLLDQ host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  71. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504608

    Description: epitope description:QPRDANGFAATL host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  72. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504613

    Description: epitope description:TMRDSNGFFIEP host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  73. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504618

    Description: epitope description:QHLLSPNVRPPH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  74. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504619

    Description: epitope description:FHTNSNVRYSHL host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  75. A peptide of foot-and-mouth disease virus serotype Asia1 generating a neutralizing antibody response, and an immunostimulatory peptide.

    ID: 1504625

    Description: epitope description:KTTYGEESTSRGDPSALAQRLSGRLPTSFNY antigen name:Genome polyprotein host organism:Cavia porcellus

    Publication: 17656048;

  76. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504639

    Description: epitope description:SWNASWLSHSYD host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  77. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504642

    Description: epitope description:CPPHPNLRGICR host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  78. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504654

    Description: epitope description:EFSIKPKTSVTP host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  79. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504670

    Description: epitope description:FAPWHVKRMLHH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  80. Potential of peptides selected from random phage-displayed libraries to mimic conformational epitopes: a study on scorpion toxin Cn2 and the neutraliz...

    ID: 1504674

    Description: epitope description:SHYNHSTHPPRH host organism:Mus musculus BALB/c antibody name:BCF2

    Publication: 12678707;

  81. Delineation of a linear epitope by multiple peptide synthesis and phage display.

    ID: 1504678

    Description: epitope description:TYNRSSYLASWP host organism:Mus musculus BALB/c antibody name:57P

    Publication: 11226482;

  82. Delineation of a linear epitope by multiple peptide synthesis and phage display.

    ID: 1504702

    Description: epitope description:IQQRASFGPHGF host organism:Mus musculus BALB/c antibody name:57P

    Publication: 11226482;

  83. Delineation of a linear epitope by multiple peptide synthesis and phage display.

    ID: 1504704

    Description: epitope description:QSAQYTINRVMM host organism:Mus musculus BALB/c antibody name:57P

    Publication: 11226482;

  84. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504709

    Description: epitope description:GYAMDHEGCKFSCFI antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  85. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504719

    Description: epitope description:CDGYCKTHLKASSGY antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  86. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504721

    Description: epitope description:CKTHLKASSGYCAWP antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  87. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504736

    Description: epitope description:YPVEYDNCAYICWNY antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  88. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504751

    Description: epitope description:ICWNYDNAYCDKLCK antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  89. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504754

    Description: epitope description:WNYDNAYCDKLCKDK antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  90. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504796

    Description: epitope description:CYCYGLPDSEPTKTN antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  91. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504799

    Description: epitope description:CYGLPDSEPTKTNGK antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  92. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504805

    Description: epitope description:PDSEPTKTNGKCKSG antigen name:Toxin-5 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  93. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504810

    Description: epitope description:GYLMDHEGCKLSCFI antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  94. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504813

    Description: epitope description:EGCKLSCFIRPSGYC antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  95. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504821

    Description: epitope description:RECGIKKGSSGYCAW antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  96. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504825

    Description: epitope description:SSGYCAWPACYCYGL antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  97. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504829

    Description: epitope description:ACYCYGLPNWVKVWD antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  98. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504831

    Description: epitope description:YGLPNWVKVWDRATN antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  99. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504840

    Description: epitope description:FSCFIRPAGFCDGYC antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  100. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504847

    Description: epitope description:CKTHLKASSGYCAWP antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston