Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944757

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 22695068;

  2. Self-assembled peptide nanofibers raising durable antibody responses against a malaria epitope.

    ID: 1944760

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

    Publication: 22695068;

  3. Rabbit serum against K1 peptide, an immunogenic epitope of the Trypanosoma cruzi KMP-11, decreases parasite invasion to cells.

    ID: 1944828

    Description: epitope description:TLEEFSAKL antigen name:Other Trypanosoma cruzi protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22687575;

  4. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944835

    Description: epitope description:KALDYEQLQSVKLSIAVKNKAEFHQSVISRYRV antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  5. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944240

    Description: epitope description:GAARDSLQ antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  6. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944248

    Description: epitope description:GFKITQNN antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  7. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944250

    Description: epitope description:KITQNNAM antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  8. Structural availability influences the capacity of autoantigenic epitopes to induce a widespread lupus-like autoimmune response.

    ID: 1944257

    Description: epitope description:MKISFAKK antigen name:Other Oryctolagus cuniculus (rabbit) protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 14988508;

  9. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944325

    Description: epitope description:alpha-D-galactose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  10. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944345

    Description: epitope description:alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  11. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944346

    Description: epitope description:alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  12. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944351

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  13. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944352

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  14. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944353

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  15. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944354

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  16. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944358

    Description: epitope description:alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  17. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944365

    Description: epitope description:alpha-Tyvp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  18. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944369

    Description: epitope description:alpha-Tyvp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  19. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944377

    Description: epitope description:alpha-tyvelopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  20. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944379

    Description: epitope description:alpha-tyvelopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  21. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944383

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-...

    Publication: 17558551;

  22. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944390

    Description: epitope description:alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp-(1->2)-[alpha-D-Abep-(1->3)]-alpha-...

    Publication: 17558551;

  23. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944397

    Description: epitope description:alpha-Parp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  24. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944400

    Description: epitope description:alpha-Parp-(1->3)-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->3)-alpha-D-Galp antigen name:lipopolysaccharide host organism:Oryctolagus c...

    Publication: 17558551;

  25. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944404

    Description: epitope description:alpha-paratopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  26. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944409

    Description: epitope description:alpha-paratopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  27. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944411

    Description: epitope description:3-O-alpha-abequopyranosyl-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Oryctolagus cuniculus

    Publication: 17558551;

  28. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944423

    Description: epitope description:[3)-alpha-D-Galp-(1->2)-[alpha-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->]3 antigen name:lipopolysaccharide host organism:...

    Publication: 17558551;

  29. Pathogen specific carbohydrate antigen microarrays: a chip for detection of Salmonella O-antigen specific antibodies.

    ID: 1944426

    Description: epitope description:[3)-alpha-D-Galp-(1->2)-[alpha-Tyvp-(1->3)]-alpha-D-Manp-(1->4)-alpha-L-Rhap-(1->]3 antigen name:lipopolysaccharide host organism:...

    Publication: 17558551;

  30. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944847

    Description: epitope description:DGGYLMIDSKTAEIKFVKNMNR antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  31. Mapping of B cell epitopes on desmoglein 3 in pemphigus vulgaris patients by the use of overlapping peptides.

    ID: 1944848

    Description: epitope description:DGGYLMIDSKTAEIKFVKNMNR antigen name:Desmoglein-3 host organism:Homo sapiens

    Publication: 22261006;

  32. Structural basis of the interaction of a Trypanosoma cruzi surface molecule implicated in oral infection with host cells and gastric mucin.

    ID: 1944853

    Description: epitope description:RANDKGSVISLARLTEELKT antigen name:Trans-sialidase, putative (UniProt:K4DRA4) host organism:Mus musculus BALB/c antibody name:3F6

    Publication: 22860068;

  33. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944966

    Description: epitope description:alpha-D-Glc-(1->2)-alpha-D-Glc-(1->3')-1,2-diacylglycerol host organism:Oryctolagus cuniculus Japanese white

    Publication: 22638862;

  34. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944987

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Oryctolagus cuniculus Japanes...

    Publication: 22638862;

  35. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944988

    Description: epitope description:N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Ory...

    Publication: 22638862;

  36. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944993

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Oryctolagus cuniculus Japanese whit...

    Publication: 22638862;

  37. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944994

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 22638862;

  38. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1944995

    Description: epitope description:N-acetyl-alpha-D-galactosaminyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->3)-alpha-D-galactosyl-(1->4)-beta-D-galactosyl-(1->4)-be...

    Publication: 22638862;

  39. Bacterial species-characteristic profiles of molecular species, and the antigenicity of phospholipids and glycolipids in symbiotic Lactobacillus, Stap...

    ID: 1945001

    Description: epitope description:alpha-D-Gal-(1->2)-alpha-D-Glc-(1->3')-1,2-diacylglycerol host organism:Homo sapiens

    Publication: 22638862;

  40. Identification of conformational epitopes and antigen-specific residues at the D/A domains and the extramembrane C-terminal region of E2 glycoprotein ...

    ID: 1945009

    Description: epitope description:E635 antigen name:Genome polyprotein host organism:Mus musculus antibody name:T6, T11

    Publication: 22727685;

  41. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945025

    Description: epitope description:LVFFAEDVGSNKGAIIGAMVGGVV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  42. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945028

    Description: epitope description:LVFFAEDVGSNKGAIIGLMVGGAV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  43. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945029

    Description: epitope description:LVFFAEDVGSNKGAIIGLMVGGAV host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  44. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945034

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  45. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945036

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  46. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945040

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  47. Structural basis of C-terminal beta-amyloid peptide binding by the antibody ponezumab for the treatment of Alzheimer's disease.

    ID: 1945041

    Description: epitope description:AIIGLMVGGVV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:ponezumab

    Publication: 22197375;

  48. Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.

    ID: 1945051

    Description: epitope description:QQQQQQQQQQQQQQQQQQQQQQQQQ antigen name:Nuclear receptor coactivator 6 host organism:Mus musculus antibody name:3B5H10

    Publication: 22306738;

  49. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945323

    Description: epitope description:VHTWTEQYK antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H7.4, 1C6.3, 1G5.4-A1-C3

    Publication: 22546090;

  50. Epitope reactions can be gauged by relative antibody discriminating specificity (RADS) values supported by deletion, substitution and cysteine bridge ...

    ID: 1945325

    Description: epitope description:YSWKTWGKA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:3D1.4

    Publication: 22546090;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston