Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505287

    Description: epitope description:LRRLLYMIYMSGLAVRVHVSKEEQYYDY antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  2. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505307

    Description: epitope description:FVRSGQPVIGACTSPYDGKYWSILYSRLRKMLY antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  3. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505311

    Description: epitope description:AGFIYRETFCITTIYKTGQPAADHYYSKVTA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  4. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505357

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus BALB/c

    Publication: 10992485;

  5. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505362

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus BALB/c

    Publication: 10992485;

  6. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505377

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus antibody name:PC2, T15

    Publication: 10992485;

  7. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505382

    Description: epitope description:ATSVLAQEYKGMGV antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  8. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505383

    Description: epitope description:QEYKGMGVETRTTE antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  9. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505387

    Description: epitope description:PVGSQGIRLSWEVQ antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  10. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505392

    Description: epitope description:PSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston