Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504849

    Description: epitope description:LKASSGYCAWPACYC antigen name:Alpha-mammal toxin Ts2 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  2. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504859

    Description: epitope description:KEGYLMDHEGCKLSC antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus BALB/c antibody name:anti-TstFG50-...

    Publication: 15302529;

  3. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504874

    Description: epitope description:KKADSGYCYWVHILC antigen name:Toxin-5 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  4. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504875

    Description: epitope description:ADSGYCYWVHILCYC antigen name:Toxin-5 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  5. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504881

    Description: epitope description:CYCYGLPDSEPTKTN antigen name:Toxin-5 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50-BSA

    Publication: 15302529;

  6. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504886

    Description: epitope description:GYLMDHEGCKLSCFI antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  7. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504889

    Description: epitope description:EGCKLSCFIRPSGYC antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  8. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504893

    Description: epitope description:IRPSGYCGRECGIKK antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  9. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504896

    Description: epitope description:CGRECGIKKGSSGYC antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  10. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504899

    Description: epitope description:IKKGSSGYCAWPACY antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  11. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504901

    Description: epitope description:SSGYCAWPACYCYGL antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  12. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504907

    Description: epitope description:YGLPNWVKVWDRATN antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  13. Molecular characterization of protective antibodies raised in mice by Tityus serrulatus scorpion venom toxins conjugated to bovine serum albumin.

    ID: 1504908

    Description: epitope description:LPNWVKVWDRATNKC antigen name:Beta-mammal/insect toxin Ts1 host organism:Mus musculus C57BL/10 antibody name:anti-TstFG50

    Publication: 15302529;

  14. Location of the Bombyx mori aminopeptidase N type 1 binding site on Bacillus thuringiensis Cry1Aa toxin.

    ID: 1504920

    Description: epitope description:VFTLSAHV antigen name:Other Bacillus thuringiensis protein host organism:Mus musculus BALB/c antibody name:1B10

    Publication: 16000811;

  15. Peptide mimotopes of pneumococcal capsular polysaccharide of 6B serotype: a peptide mimotope can bind to two unrelated antibodies.

    ID: 1504956

    Description: epitope description:NPKFSPP host organism:Mus musculus BALB/c antibody name:Hyp6BM1

    Publication: 12055241;

  16. Vaccinia virus entry/fusion complex subunit A28 is a target of neutralizing and protective antibodies.

    ID: 1504972

    Description: epitope description:MNSLSIFFIVVATAAVCLLF antigen name:Envelope protein A28 host organism:Oryctolagus cuniculus

    Publication: 18789472;

  17. Vaccinia virus entry/fusion complex subunit A28 is a target of neutralizing and protective antibodies.

    ID: 1504977

    Description: epitope description:ENYGNIKEFNATHAAFEYSK antigen name:Envelope protein A28 host organism:Oryctolagus cuniculus

    Publication: 18789472;

  18. Vaccinia virus entry/fusion complex subunit A28 is a target of neutralizing and protective antibodies.

    ID: 1504982

    Description: epitope description:WRCVVYPGNGFVSASIFGFQ antigen name:Envelope protein A28 host organism:Oryctolagus cuniculus

    Publication: 18789472;

  19. Vaccinia virus entry/fusion complex subunit A28 is a target of neutralizing and protective antibodies.

    ID: 1504988

    Description: epitope description:SDVININIYNPCVVPNINNA antigen name:Envelope protein A28 host organism:Oryctolagus cuniculus

    Publication: 18789472;

  20. Vaccinia virus entry/fusion complex subunit A28 is a target of neutralizing and protective antibodies.

    ID: 1504989

    Description: epitope description:NPCVVPNINNAECQFLKSVL antigen name:Envelope protein A28 host organism:Oryctolagus cuniculus

    Publication: 18789472;

  21. Construction and functional activities of chimeric mouse-human immunoglobulin G and immunoglobulin M antibodies against the Neisseria meningitidis Por...

    ID: 1505076

    Description: epitope description:ASGQ antigen name:Major outer membrane protein P.IA host organism:Mus musculus antibody name:208,D5

    Publication: 14500492;

  22. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505091

    Description: epitope description:PQEQITQHGSPYGRC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  23. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505096

    Description: epitope description:STPGIVIPPQEQITQHGSPYGRC antigen name:Pertussis toxin subunit 2 host organism:Homo sapiens

    Publication: 1383153;

  24. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505241

    Description: epitope description:PKALFTQQGGAYGRC antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  25. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505242

    Description: epitope description:STPGIVIPPQEQITQHGSPYGRC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  26. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505244

    Description: epitope description:GAYGRCPNGTRALTVAELRGNAEL antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  27. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505253

    Description: epitope description:LRRLLYMIYMSGLAVRVHVSKEEQYYDY antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  28. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505256

    Description: epitope description:STPGIVIPPQEQITQHGSPYGRC antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  29. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505261

    Description: epitope description:CITTIYKTGQPAADHYYSKVTA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  30. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505282

    Description: epitope description:GAFDLKTTFCIMTTRNTGQPA antigen name:Pertussis toxin subunit 2 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  31. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505287

    Description: epitope description:LRRLLYMIYMSGLAVRVHVSKEEQYYDY antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  32. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505307

    Description: epitope description:FVRSGQPVIGACTSPYDGKYWSILYSRLRKMLY antigen name:Pertussis toxin subunit 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  33. Identification of T- and B-cell epitopes of the S2 and S3 subunits of pertussis toxin by use of synthetic peptides.

    ID: 1505311

    Description: epitope description:AGFIYRETFCITTIYKTGQPAADHYYSKVTA antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 1383153;

  34. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505357

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus BALB/c

    Publication: 10992485;

  35. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505362

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus BALB/c

    Publication: 10992485;

  36. Peptide mimic of phosphorylcholine, a dominant epitope found on Streptococcus pneumoniae.

    ID: 1505377

    Description: epitope description:ASRNKANDYTTEYSASVKGRFIVS antigen name:Immunoglobulin host organism:Mus musculus antibody name:PC2, T15

    Publication: 10992485;

  37. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505382

    Description: epitope description:ATSVLAQEYKGMGV antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  38. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505383

    Description: epitope description:QEYKGMGVETRTTE antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  39. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505387

    Description: epitope description:PVGSQGIRLSWEVQ antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  40. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505392

    Description: epitope description:PSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  41. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505399

    Description: epitope description:ILGFTVDIETPRAG antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  42. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505403

    Description: epitope description:SALTSAIAGFVFSC antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  43. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505411

    Description: epitope description:NSARVQLCLILFAT host organism:Ovis aries

    Publication: 11027814;

  44. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505438

    Description: epitope description:ATSVLAQEYKGMGV antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  45. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505441

    Description: epitope description:TETPLRKHFNLTPV antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  46. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505442

    Description: epitope description:KHFNLTPVGSQGIR antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  47. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505445

    Description: epitope description:KMTVEAVKAKKTIL antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  48. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505454

    Description: epitope description:LKGTDISLKAVNPS antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  49. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505455

    Description: epitope description:SLKAVNPSDPLVYK antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  50. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505456

    Description: epitope description:PSDPLVYKRQTAKF antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  51. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505484

    Description: epitope description:VKAKKTILGFTVDI antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  52. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505488

    Description: epitope description:IAGFVFSCIVVVLT antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  53. Protection against hydatid disease induced with the EG95 vaccine is associated with conformational epitopes.

    ID: 1505490

    Description: epitope description:KMTVEAVKAKKTIL antigen name:Antigen protein host organism:Ovis aries

    Publication: 11027814;

  54. Characterization of epitopes for virus-neutralizing monoclonal antibodies to Ross River virus E2 using phage-displayed random peptide libraries.

    ID: 1505507

    Description: epitope description:SLTILRR host organism:Mus musculus BALB/c antibody name:NB3C4, T1E7

    Publication: 11017788;

  55. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505514

    Description: epitope description:KNTMEHVSSSEESIISQETY antigen name:Bos d 10 host organism:Homo sapiens

    Publication: 18774394;

  56. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505518

    Description: epitope description:RINKKIEKFQSEEQQQTEDELQDKIH antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 18774394;

  57. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505520

    Description: epitope description:TVMFPPQSVLSLSQSKVLPV antigen name:Bos d 11 host organism:Homo sapiens

    Publication: 18774394;

  58. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505522

    Description: epitope description:RYPSYGLNYYQQKPVALINN antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 18774394;

  59. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505524

    Description: epitope description:PNSVEQKHIQKEDVPSERYL antigen name:Bos d 9 host organism:Homo sapiens

    Publication: 18774394;

  60. Mapping of the IgE and IgG4 sequential epitopes of milk allergens with a peptide microarray-based immunoassay.

    ID: 1505534

    Description: epitope description:RFFSDKIAKYIPIQYVLSRY antigen name:Bos d 12 host organism:Homo sapiens

    Publication: 18774394;

  61. Molecular basis for the cross-reactivity of antibodies elicited by a natural anatoxin with alpha- and beta-toxins from the venom of Tityus serrulatus ...

    ID: 1503671

    Description: epitope description:GREGYPADSKGCKIT antigen name:Toxin Ts4 host organism:Mus musculus CF-1

    Publication: 11922945;

  62. New virus-specific T-helper epitopes of foot-and-mouth disease viral VP1 protein.

    ID: 1503716

    Description: epitope description:FVKIQNLNPIHVIDLMQTHQHGL antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 7693508;

  63. Rapid pathotyping of Newcastle disease virus using a single-chain Fv displayed on phage against the C-terminal end of the F2 polypeptide.

    ID: 1503739

    Description: epitope description:VTTSGGRRQ antigen name:Fusion glycoprotein F0 host organism:Oryctolagus cuniculus antibody name:L21D7

    Publication: 12376763;

  64. Functional characterization of fingers subdomain-specific monoclonal antibodies inhibiting the hepatitis C virus RNA-dependent RNA polymerase.

    ID: 1503760

    Description: epitope description:TPPHSARSKFGYGA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:7G8

    Publication: 18574240;

  65. Production and characterization of two serotype independent monoclonal antibodies against foot-and-mouth disease virus.

    ID: 1503770

    Description: epitope description:DKKTEETTLLEDRIL antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:F1412SA

    Publication: 17109972;

  66. Characterization of an immunodominant epitope of small ruminant lentivirus (SRLV) nucleoprotein.

    ID: 1503783

    Description: epitope description:GIICHNCGKRGHMKKDCRGKK antigen name:gag protein host organism:Capra hircus

    Publication: 18584880;

  67. Characterization of an immunodominant epitope of small ruminant lentivirus (SRLV) nucleoprotein.

    ID: 1503785

    Description: epitope description:DCRQKGGDKGQSQQQG antigen name:gag protein host organism:Capra hircus

    Publication: 18584880;

  68. Characterization of an immunodominant epitope of small ruminant lentivirus (SRLV) nucleoprotein.

    ID: 1503786

    Description: epitope description:QSQQQGNSRRGPRVVP antigen name:gag protein host organism:Capra hircus

    Publication: 18584880;

  69. Characterization of an immunodominant epitope of small ruminant lentivirus (SRLV) nucleoprotein.

    ID: 1503787

    Description: epitope description:GNSRRGPRVVPSAPPML antigen name:gag protein host organism:Capra hircus

    Publication: 18584880;

  70. Characterization of immunity induced by M2e of influenza virus.

    ID: 1503798

    Description: epitope description:SLLTEVETPIRNEWGCRCNDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 18061317;

  71. Identification of two novel B cell epitopes on porcine epidemic diarrhea virus spike protein.

    ID: 1503849

    Description: epitope description:YSNIGVCK antigen name:Spike glycoprotein host organism:Mus musculus BALB/c antibody name:2C4, 3C3, and 5F8

    Publication: 18400422;

  72. MHC-peptide-specific antibodies reveal inefficient presentation of an HLA-A*0201-restricted, Melan-A-derived peptide after active intracellular proces...

    ID: 1503884

    Description: epitope description:EAAGIGILTV antigen name:Melanoma antigen recognized by T-cells 1 host organism:Homo sapiens antibody name:2M3F11, 3N4E9, 2N4B4, 3N...

    Publication: 17559180;

  73. MHC-peptide-specific antibodies reveal inefficient presentation of an HLA-A*0201-restricted, Melan-A-derived peptide after active intracellular proces...

    ID: 1503885

    Description: epitope description:ELAGIGILTV host organism:Homo sapiens antibody name:2M3F11, 3N4E9, 2N4B4, 3N4B5, E6, H4

    Publication: 17559180;

  74. MHC-peptide-specific antibodies reveal inefficient presentation of an HLA-A*0201-restricted, Melan-A-derived peptide after active intracellular proces...

    ID: 1503888

    Description: epitope description:ELAGIGILTV host organism:Homo sapiens antibody name:2M3F11, 3N4E9, 2N4B4, 3N4B5, E6, H4

    Publication: 17559180;

  75. Diagnostic evaluation of a synthetic peptide derived from a novel antigen B subunit as related to other available peptides and native antigens used fo...

    ID: 1503992

    Description: epitope description:NDLTAICQKLQLKIREVLKKYVKNLVEEKDDDSK antigen name:AgB2 host organism:Homo sapiens

    Publication: 9572048;

  76. Identification of a neutralizing epitope in the betaE-betaF loop of VP1 of equine rhinitis A virus, defined by a neutralization-resistant variant.

    ID: 1504101

    Description: epitope description:E658 antigen name:polyprotein host organism:Equus caballus

    Publication: 15302948;

  77. Reduced allergenic potency of VR9-1, a mutant of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504128

    Description: epitope description:ESKIVELEEELRVVG antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 16339577;

  78. The molecular basis of antigenic cross-reactivity between the group 2 mite allergens.

    ID: 1504152

    Description: epitope description:H31, R32, K34, S58, K97, I98, K101, E103 antigen name:Der p 2 host organism:Mus musculus A/J antibody name:7A1

    Publication: 11398074;

  79. Analysis of the epitopes on staphylococcal enterotoxin A responsible for emetic activity.

    ID: 1504185

    Description: epitope description:KESHDQFLQHTILFKGFFTD antigen name:Enterotoxin type A host organism:Oryctolagus cuniculus albino

    Publication: 11307922;

  80. Analysis of the epitopes on staphylococcal enterotoxin A responsible for emetic activity.

    ID: 1504194

    Description: epitope description:EEKKVPINLWLDGKQNTVPL antigen name:Enterotoxin type A host organism:Oryctolagus cuniculus albino

    Publication: 11307922;

  81. Analysis of the epitopes on staphylococcal enterotoxin A responsible for emetic activity.

    ID: 1504197

    Description: epitope description:ETVKTNKKNVTVQELDLQAR antigen name:Enterotoxin type A host organism:Oryctolagus cuniculus albino

    Publication: 11307922;

  82. Analysis of the epitopes on staphylococcal enterotoxin A responsible for emetic activity.

    ID: 1504205

    Description: epitope description:SENMHIDIYLYTS antigen name:Enterotoxin type A host organism:Oryctolagus cuniculus albino

    Publication: 11307922;

  83. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1504210

    Description: epitope description:VAPGIVIPPKAL antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  84. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1504215

    Description: epitope description:DALRRLLYMIYMSG antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  85. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1504224

    Description: epitope description:VAPGIVIPPKAL antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  86. Identification of linear B-cell determinants of pertussis toxin associated with the receptor recognition site of the S3 subunit.

    ID: 1504225

    Description: epitope description:CPNGTRALTV antigen name:Pertussis toxin subunit 3 host organism:Oryctolagus cuniculus Chinchilla Bastard

    Publication: 1706321;

  87. Anti-allergen antibodies can be neutralized by antibodies obtained against a peptide complementary to the allergen: towards a new peptide therapy for ...

    ID: 1504297

    Description: epitope description:VYVEELKPTPEGDLEILLQK antigen name:Bos d 5 host organism:Oryctolagus cuniculus Blanc de Bouscat

    Publication: 11750046;

  88. Strongyloides stercoralis recombinant NIE antigen shares epitope with recombinant Ves v 5 and Pol a 5 allergens of insects.

    ID: 1504320

    Description: epitope description:NSARDENGKLIYTYNGNDYDTKEAM antigen name:Strongyloides stercoralis protein host organism:Oryctolagus cuniculus

    Publication: 15891128;

  89. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504357

    Description: epitope description:DLERAEERAETGESK antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  90. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504358

    Description: epitope description:LEKDNAMDRADTLEQ antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  91. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504373

    Description: epitope description:VAALNRRIQLLEEDL antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  92. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504376

    Description: epitope description:EASQAADESERMRKV antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  93. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504381

    Description: epitope description:EANNRAEKSEEEVHN antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  94. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504384

    Description: epitope description:NDLDQVQESLLKANI antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  95. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504388

    Description: epitope description:VVGNNLKSLEVSEEK antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  96. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504391

    Description: epitope description:AEARAEFAERSVQKL antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  97. Identification of continuous, allergenic regions of the major shrimp allergen Pen a 1 (tropomyosin).

    ID: 1504392

    Description: epitope description:FAERSVQKLQKEVDR antigen name:Pen a 1 allergen host organism:Homo sapiens

    Publication: 11893851;

  98. Epitope mapping and protective immunity elicited by adenovirus expressing the Leishmania amastigote specific A2 antigen: correlation with IFN-gamma an...

    ID: 1504402

    Description: epitope description:SASAEPHKAAVDVGPLSVGPQ antigen name:Other Leishmania donovani protein host organism:Mus musculus BALB/c

    Publication: 18588933;

  99. Epitope mapping and protective immunity elicited by adenovirus expressing the Leishmania amastigote specific A2 antigen: correlation with IFN-gamma an...

    ID: 1504407

    Description: epitope description:VGPQSVGPL antigen name:Other Leishmania donovani protein host organism:Mus musculus BALB/c

    Publication: 18588933;

  100. Epitope mapping and protective immunity elicited by adenovirus expressing the Leishmania amastigote specific A2 antigen: correlation with IFN-gamma an...

    ID: 1504408

    Description: epitope description:SASAEPHKAAVDVGPLSVGPQ antigen name:Other Leishmania donovani protein host organism:Mus musculus BALB/c

    Publication: 18588933;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston