Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

ID: 1340665

Description: epitope description:GGQSESVEFTKDTQT antigen name:UniProt:A2RC81 host organism:Mus musculus

Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

ID: 1340666

Description: epitope description:SESVEFTKDTQTGMS antigen name:UniProt:A2RC81 host organism:Mus musculus

Identification of B- and T-cell epitopes within the fibronectin-binding domain of the SfbI protein of Streptococcus pyogenes.

ID: 1340668

Description: epitope description:TKDTQTGMSGQTTPQ antigen name:UniProt:A2RC81 host organism:Mus musculus

Potent immunogenic short linear peptide constructs composed of B cell epitopes and Pan DR T helper epitopes (PADRE) for antibody responses in vivo.

ID: 1340710

Description: epitope description:NANPNANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus C57BL/6

Antigenicity of recombinant proteins derived from Plasmodium falciparum merozoite surface protein 1.

ID: 1340717

Description: epitope description:THESYQELVKKLEALEDAVLTGYGLFHKEKMIL antigen name:Merozoite surface protein 1 host organism:Mus musculus CBA/Ca antibody name:Mouse s...

Synthesis of a diepitope multiple antigen peptide containing sequences from two malaria antigens using Fmoc chemistry.

ID: 1340719

Description: epitope description:VTEEIVTEEIVTEEI host organism:Mus musculus C57BL/10 X DBA/2 antibody name:B10.D2

Structural and antigenic properties of merozoite surface protein 4 of Plasmodium falciparum.

ID: 1340729

Description: epitope description:DLCKHNNGDCGDDKLCEYVGNRRVKCKCKEGYKLEGIECVELLSL antigen name:Merozoite surface protein 4 host organism:Oryctolagus cuniculus New Zea...

Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

ID: 1340731

Description: epitope description:LDNIKGNVGKNEDYIKKNKK antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

Fine specificity of immune responses to epitopic sequences in synthetic peptides containing B and T epitopes from the conserved Plasmodium falciparum ...

ID: 1340739

Description: epitope description:EENVEHDAEENVEENV antigen name:DNAJ protein, putative host organism:Mus musculus BALB/c

Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

ID: 1340747

Description: epitope description:NSGCFRHLDEREECKCLL antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

ID: 1340748

Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

ID: 1340751

Description: epitope description:DGNCEDIPHVNEFSAIDL antigen name:Apical membrane antigen 1 host organism:Mus musculus ICR

Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

ID: 1340755

Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Mus musculus ICR

Influence of adjuvants in inducing immune responses to different epitopes included in a multiepitope, multivalent, multistage Plasmodium falciparum ca...

ID: 1340764

Description: epitope description:GISYYEKVLAKYKDDLE antigen name:Merozoite surface protein 1 host organism:Mus musculus ICR

Immunogenicity of four Plasmodium falciparum preerythrocytic antigens in Aotus lemurinus monkeys.

ID: 1340775

Description: epitope description:DELFNELLNSVDVNGEVKENILEESQ antigen name:Liver stage antigen 3 host organism:Aotus lemurinus

Immunogenicity of four Plasmodium falciparum preerythrocytic antigens in Aotus lemurinus monkeys.

ID: 1340816

Description: epitope description:SAEKKDEKEASEQGEESHKKENSQESA antigen name:Merozoite surface protein 4 host organism:Aotus lemurinus

Human antibodies to the 19kDa C-terminal fragment of Plasmodium falciparum merozoite surface protein 1 inhibit parasite growth in vitro.

ID: 1340863

Description: epitope description:NPNPTCNENNGGCDADATCTEEDSGSSRKKITCECTKPDSYPLFDGIFCSSSN antigen name:Merozoite surface protein 1 host organism:Homo sapiens antibody...

Co-dominant and reciprocal T-helper cell activity of epitopic sequences and formation of junctional B-cell determinants in synthetic T:B chimeric immu...

ID: 1340864

Description: epitope description:QYIKANSKFIGITEL antigen name:Tetanus toxin host organism:Oryctolagus cuniculus New Zealand White

Co-dominant and reciprocal T-helper cell activity of epitopic sequences and formation of junctional B-cell determinants in synthetic T:B chimeric immu...

ID: 1340865

Description: epitope description:DIEKKIAKMEKASSVFNVVNS host organism:Oryctolagus cuniculus New Zealand White

A multiple antigen peptide from the repetitive sequence of the Plasmodium malariae circumsporozoite protein induces a specific antibody response in mi...

ID: 1340916

Description: epitope description:NAAGNAAGNAAGNAAGNAAGNAAG antigen name:Circumsporozoite protein host organism:Mus musculus C3H/He