Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1831723

    Description: epitope description:GPGTIKKISF antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:2, 4, 10

    Publication: 21451110;

  2. Mapping of conformational IgE epitopes with peptide-specific monoclonal antibodies reveals simultaneous binding of different IgE antibodies to a surfa...

    ID: 1831729

    Description: epitope description:GPGTIKKISF antigen name:Bet v 1 host organism:Mus musculus BALB/c antibody name:2, 10

    Publication: 21451110;

  3. A modular approach to assembly of totally synthetic self-adjuvanting lipopeptide-based vaccines allows conformational epitope building.

    ID: 1831732

    Description: epitope description:HWSYGLRPG antigen name:Progonadoliberin-1 host organism:Mus musculus BALB/c

    Publication: 21321114;

  4. Porcine reproductive and respiratory syndrome virus (PRRSV)-specific mAbs: supporting diagnostics and providing new insights into the antigenic proper...

    ID: 1831746

    Description: epitope description:HHQIDGGNWFHL antigen name:Glycoprotein 3 host organism:Mus musculus BALB/c antibody name:I12G/5-4F

    Publication: 21470695;

  5. Lack of correlation between Lewis antigen expression by Helicobacter pylori and gastric epithelial cells in infected patients.

    ID: 1831762

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:lipopolysaccharide host organism:Mus musculus antibody name:B...

    Publication: 9797366;

  6. Recombinant immunotoxin against B-cell malignancies with no immunogenicity in mice by removal of B-cell epitopes.

    ID: 1831844

    Description: epitope description:R437, D488, R515, R601, K631 antigen name:Exotoxin A host organism:Mus musculus antibody name:MAb 13, 8, 25, 55

    Publication: 21436054;

  7. Recombinant immunotoxin against B-cell malignancies with no immunogenicity in mice by removal of B-cell epitopes.

    ID: 1831847

    Description: epitope description:E445, D614, K615 antigen name:Exotoxin A host organism:Mus musculus antibody name:MAb 73, 52, 69

    Publication: 21436054;

  8. Autoantigen discovery with a synthetic human peptidome.

    ID: 1831850

    Description: epitope description:PKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVM antigen name:E3 ubiquitin-protein ligase TRIM9 host organism:Homo sapiens

    Publication: 21602805;

  9. Production of anti-amyloid beta antibodies in mice fed rice expressing amyloid beta.

    ID: 1831864

    Description: epitope description:EVHHQKLVFFAEDVGSNK antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 21307566;

  10. Production of anti-amyloid beta antibodies in mice fed rice expressing amyloid beta.

    ID: 1831866

    Description: epitope description:GSNKGAIIGLM antigen name:Amyloid beta A4 protein host organism:Mus musculus C57BL/6

    Publication: 21307566;

  11. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831878

    Description: epitope description:GPTHAMFDSSGP host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  12. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831879

    Description: epitope description:KGTHSLYSQIAG host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  13. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831887

    Description: epitope description:QGTHPGLWRXTLLLL host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  14. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831888

    Description: epitope description:GPHPTLEVVPMGRGS host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  15. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831894

    Description: epitope description:GTFCGGEECMRG host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  16. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831896

    Description: epitope description:TGGCTHGCLAVP host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  17. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831898

    Description: epitope description:GTHPFLSQW host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  18. Antigenicity and immunogenicity of phage library-selected peptide mimics of the major surface proteophosphoglycan antigens of Entamoeba histolytica.

    ID: 1831899

    Description: epitope description:CSGTHPSISSC host organism:Mus musculus BALB/c antibody name:EH5

    Publication: 12102717;

  19. Complex pharmacokinetics of a humanized antibody against human amyloid beta peptide, anti-abeta Ab2, in nonclinical species.

    ID: 1831903

    Description: epitope description:EFRH antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:Ab2

    Publication: 21424161;

  20. Identification of surface-exposed linear B-cell epitopes of the nonfimbrial adhesin CS31A of Escherichia coli by using overlapping peptides and antipe...

    ID: 1832095

    Description: epitope description:DFNGSFDMNGTITA antigen name:Other Escherichia coli protein host organism:Oryctolagus cuniculus

    Publication: 8751899;

  21. Identification of surface-exposed linear B-cell epitopes of the nonfimbrial adhesin CS31A of Escherichia coli by using overlapping peptides and antipe...

    ID: 1832100

    Description: epitope description:QAVNPNAGN antigen name:Other Escherichia coli protein host organism:Oryctolagus cuniculus

    Publication: 8751899;

  22. Three novel beta3 domain-deletion peptides for the sensitive and specific detection of HPA-4 and six low frequency beta3-HPA antibodies.

    ID: 1832945

    Description: epitope description:R169 antigen name:Integrin beta-3 host organism:Homo sapiens antibody name:A1, A2

    Publication: 18031296;

  23. Three novel beta3 domain-deletion peptides for the sensitive and specific detection of HPA-4 and six low frequency beta3-HPA antibodies.

    ID: 1832946

    Description: epitope description:R169 antigen name:Integrin beta-3 host organism:Homo sapiens antibody name:A3, A4, A5

    Publication: 18031296;

  24. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832982

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus antib...

    Publication: 10814702;

  25. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832983

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus BALB/...

    Publication: 10814702;

  26. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832987

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus antibody name:22-1B3-A,...

    Publication: 10814702;

  27. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832988

    Description: epitope description:alpha-L-Fucp-(1->3)-[beta-D-Galp-(1->4)]-beta-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus antibody name:259-3E11,...

    Publication: 10814702;

  28. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832992

    Description: epitope description:beta-D-GalpNAc-(1->4)-beta-D-GlcpNAc-(1->3)-alpha-D-Galp antigen name:glycolipid host organism:Mus musculus antibody name:259-2A1

    Publication: 10814702;

  29. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832995

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->2)-alpha-L-Fucp-(1->3)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus BALB/...

    Publication: 10814702;

  30. Various stages of schistosoma express Lewis(x), LacdiNAc, GalNAcbeta1-4 (Fucalpha1-3)GlcNAc and GalNAcbeta1-4(Fucalpha1-2Fucalpha1-3)GlcNAc carbohydra...

    ID: 1832998

    Description: epitope description:beta-D-GalpNAc-(1->4)-[alpha-L-Fucp-(1->3)]-D-GlcpNAc antigen name:glycolipid host organism:Mus musculus antibody name:294-2A1

    Publication: 10814702;

  31. Functional intracellular antibody fragments do not require invariant intra-domain disulfide bonds.

    ID: 1832999

    Description: epitope description:S17, Q25, H27, V29, E31, Y32, D33, P34, T35, I36, E37, D38, S39, Y40, Q61, E63, Y64 antigen name:GTPase HRas host organism:Homo sa...

    Publication: 18187153;

  32. Epitope mapping and structural analysis of the anti-Der p 1 monoclonal antibody: insight into therapeutic potential.

    ID: 1833005

    Description: epitope description:AREQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAV antigen name:Der p 1 host organism:Mus musculus BALB/c antibody name:W108

    Publication: 21567139;

  33. Design and evaluation of a 6-mer amyloid-beta protein derived phage display library for molecular targeting of amyloid plaques in Alzheimer's disease:...

    ID: 1833011

    Description: epitope description:LVFFAEDV antigen name:Amyloid beta A4 protein host organism:Mus musculus antibody name:4G8

    Publication: 21575663;

  34. Characterization of the anti-A antibody binding in an ABO-incompatible living donor renal transplantation.

    ID: 1833080

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc antigen name:glycolipid host organism:Homo sapiens

    Publication: 7800218;

  35. Characterization of the anti-A antibody binding in an ABO-incompatible living donor renal transplantation.

    ID: 1833082

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-beta-D-GlcpNAc antigen name:glycolipid host organism:Homo sapiens

    Publication: 7800218;

  36. Characterization of the anti-A antibody binding in an ABO-incompatible living donor renal transplantation.

    ID: 1833086

    Description: epitope description:alpha-D-GalpNAc-(1->3)-[alpha-L-Fucp-(1->2)]-beta-D-Galp-(1->3)-alpha-D-GalpNAc antigen name:glycolipid host organism:Homo sapiens

    Publication: 7800218;

  37. Identification and characterization of protective epitope of Trichinella spiralis paramyosin.

    ID: 1833094

    Description: epitope description:EEAEGTTDAQIDANRKRESE antigen name:Paramyosin host organism:Mus musculus BALB/c antibody name:7E2

    Publication: 21382481;

  38. Immunogenic characterization and epitope mapping of transmissible gastroenteritis virus RNA dependent RNA polymerase.

    ID: 1833096

    Description: epitope description:TKYTMM antigen name:Replicase polyprotein 1ab host organism:Mus musculus BALB/c antibody name:4D10

    Publication: 21513742;

  39. Delineation of an epitope on domain I of Japanese encephalitis virus Envelope glycoprotein using monoclonal antibodies.

    ID: 1833179

    Description: epitope description:ATWVDLVLEGDSCLTI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:NHA-I

    Publication: 21477626;

  40. Delineation of an epitope on domain I of Japanese encephalitis virus Envelope glycoprotein using monoclonal antibodies.

    ID: 1833181

    Description: epitope description:ATWVDLVLEGDSCLTI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:NHA-I

    Publication: 21477626;

  41. Delineation of an epitope on domain I of Japanese encephalitis virus Envelope glycoprotein using monoclonal antibodies.

    ID: 1833184

    Description: epitope description:ATWVDLVLEGDSCLTI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:NHA-I

    Publication: 21477626;

  42. Induction of anti-progesterone immunity and pregnancy blocking by anti-progesterone anti-idiotypes. Variable efficacy of polyclonal Ab2 antibodies dir...

    ID: 1833209

    Description: epitope description:progesterone host organism:Mus musculus BALB/c antibody name:Db3, 10/8, 10/16, 11/32, 11/64

    Publication: 1908822;

  43. Induction of anti-progesterone immunity and pregnancy blocking by anti-progesterone anti-idiotypes. Variable efficacy of polyclonal Ab2 antibodies dir...

    ID: 1833212

    Description: epitope description:progesterone host organism:Mus musculus BALB/c

    Publication: 1908822;

  44. Limited regions of the alpha 2-domain alpha-helix control anti-A2 allorecognition: an analysis using a panel of A2 mutants.

    ID: 1833274

    Description: epitope description:N198, G199, R205 antigen name:HLA class I histocompatibility antigen, A-2 alpha chain host organism:Mus musculus antibody name:MA2...

    Publication: 1894309;

  45. Novel affinity tag system using structurally defined antibody-tag interaction: application to single-step protein purification.

    ID: 1833277

    Description: epitope description:PRGYPGQV antigen name:Proteinase-activated receptor 4 host organism:Mus musculus BALB/c antibody name:P20.1

    Publication: 18787202;

  46. Characterisation of the anti-A antibody response following an ABO incompatible (A2 to O) kidney transplantation.

    ID: 1833352

    Description: epitope description:alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->4)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1->1')-Cer host or...

    Publication: 1373469;

  47. Characterisation of the anti-A antibody response following an ABO incompatible (A2 to O) kidney transplantation.

    ID: 1833353

    Description: epitope description:alpha-D-GalNAc-(1->3)-[alpha-L-Fuc-(1->2)]-beta-D-Gal-(1->3)-beta-D-GalNAc-(1->3)-alpha-D-Gal-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-...

    Publication: 1373469;

  48. A modular approach to assembly of totally synthetic self-adjuvanting lipopeptide-based vaccines allows conformational epitope building.

    ID: 1833357

    Description: epitope description:HWSYGLRPG antigen name:Progonadoliberin-1 host organism:Mus musculus BALB/c

    Publication: 21321114;

  49. Characterisation of the epitope for a herpes simplex virus glycoprotein B-specific monoclonal antibody with high protective capacity.

    ID: 1833359

    Description: epitope description:PFYGYRE antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:2c

    Publication: 20931340;

  50. Characterisation of the epitope for a herpes simplex virus glycoprotein B-specific monoclonal antibody with high protective capacity.

    ID: 1833363

    Description: epitope description:PFYGYRE antigen name:Envelope glycoprotein B host organism:Mus musculus BALB/c antibody name:2c

    Publication: 20931340;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston