Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509901

    Description: epitope description:LCWGELMTLATWVGVNLEDPASRDL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  2. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509903

    Description: epitope description:FHISCLTFGRETVIEYLVSFG antigen name:External core antigen host organism:Homo sapiens

    Publication: 7505307;

  3. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509907

    Description: epitope description:VNLEDPASRDL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  4. Characterization of minor and major antigenic regions within the hepatitis B virus nucleocapsid.

    ID: 1509909

    Description: epitope description:VSYVNTNMGLKFRQL antigen name:Capsid protein host organism:Homo sapiens

    Publication: 7505307;

  5. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509912

    Description: epitope description:GDVTSYAQIITNQIGMKAIKDGSASQRNV antigen name:Outer membrane protein P1 host organism:Mus musculus A/J

    Publication: 7558276;

  6. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509917

    Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Mus musculus A/J

    Publication: 7558276;

  7. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509932

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Cavia porcellus

    Publication: 7558276;

  8. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509934

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Cavia porcellus

    Publication: 7558276;

  9. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509943

    Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  10. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509959

    Description: epitope description:LYEKLTLRAGIAYDQAASRHHRSAAIPDTDRT antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston