Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509961

    Description: epitope description:LFKTAQFSTGGVYIDSRINMNGDVTS antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;

  2. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1509962

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Homo sapiens

    Publication: 7558276;

  3. Determinants of OmpF porin antigenicity and structure.

    ID: 1510127

    Description: epitope description:AYSDDFFVGRV antigen name:Outer membrane protein F host organism:Mus musculus BALB/c antibody name:25

    Publication: 1691177;

  4. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510156

    Description: epitope description:GDVTSYAQIITNQIGMKAIKDGSASQRNV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  5. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510159

    Description: epitope description:ALSTQQEPFRDLKKYLPSKDKSVVSLQDRA antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  6. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510163

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  7. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510165

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  8. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510167

    Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  9. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510179

    Description: epitope description:KLHASFEDGKKAFDKELQYSNNSRV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;

  10. Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.

    ID: 1510181

    Description: epitope description:LSVDLGYAYLKGKKVHFKEVKTIGDKRTL antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus

    Publication: 7558276;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston