Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.
ID: 1510183
Description: epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus
Publication: 7558276;Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.
ID: 1510193
Description: epitope description:AAFQLAEVSTSGLGRAYAGEAAIADNASV antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus
Publication: 7558276;Synthetic peptides as functional mimics of a viral discontinuous antigenic site.
ID: 1510206
Description: epitope description:PSQNFGHMHKVVLPPPPPPPPPPCFLMFENVPY + OX(C24) host organism:Bos taurus antibody name:anti-D8
Publication: 11851326;Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.
ID: 1510233
Description: epitope description:VNDKFALGAGMNVNFGLKSEYDDSYDAGVFGGKTD antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus
Publication: 7558276;Immunogenicity of synthetic peptides of Haemophilus influenzae type b outer membrane protein P1.
ID: 1510237
Description: epitope description:IDFADRTATSLEANVIKEGKKGNLTFTLPDYLELSG antigen name:Outer membrane protein P1 host organism:Oryctolagus cuniculus
Publication: 7558276;ID: 1510336
Description: epitope description:EKKIAKMEKASSVFNVVN host organism:Mus musculus CBA
Publication: 10320644;ID: 1510383
Description: epitope description:SANNDAEIGNLI antigen name:60 kDa chaperonin host organism:Homo sapiens
Publication: 9498452;IgG subclass-associated differences in anti-schistosomal antibody specificity.
ID: 1510397
Description: epitope description:LVAAGVDYEDERISFQDWPK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens
Publication: 7997850;IgG subclass-associated differences in anti-schistosomal antibody specificity.
ID: 1510398
Description: epitope description:VKWMLESLAIARYMAKKHHMMG antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens
Publication: 7997850;Characterization of monoclonal antibodies against Naja naja oxiana neurotoxin I.
ID: 1510430
Description: epitope description:CAPGQNLCY antigen name:Alpha-elapitoxin-Nno2a host organism:Mus musculus ICR antibody name:835, 847, 840, 849, 850, 823, 841, 848
Publication: 7945236;