Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. The serum albumin-binding region of streptococcal protein G: a bacterial fusion partner with carrier-related properties.

    ID: 1340263

    Description: epitope description:EENVEENVEENVEENVEENVEENV antigen name:DNAJ protein, putative host organism:Oryctolagus cuniculus New Zealand White

    Publication: 9032414;

  2. Immunogenicity and in vitro protective efficacy of a recombinant multistage Plasmodium falciparum candidate vaccine.

    ID: 1340272

    Description: epitope description:LTPLEELY antigen name:Rhoptry-associated protein 1, RAP1 host organism:Oryctolagus cuniculus New Zealand White antibody name:anti-...

    Publication: 9990073;

  3. Immunogenicity and in vitro protective efficacy of a recombinant multistage Plasmodium falciparum candidate vaccine.

    ID: 1340280

    Description: epitope description:GQHGHMHG antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Oryctolagus cuniculus New...

    Publication: 9990073;

  4. Human immune response in Plasmodium falciparum malaria. Synthetic peptides corresponding to known epitopes of the Pf155/RESA antigen induce production...

    ID: 1340296

    Description: epitope description:EENVEHDAEENVEHDA antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1717554;

  5. Human immune response in Plasmodium falciparum malaria. Synthetic peptides corresponding to known epitopes of the Pf155/RESA antigen induce production...

    ID: 1340299

    Description: epitope description:LGRSGGDIIKKMQTL antigen name:DNAJ protein, putative host organism:Homo sapiens

    Publication: 1717554;

  6. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1340324

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus C57BL/10

    Publication: 8088872;

  7. Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

    ID: 1340325

    Description: epitope description:NIDRIYDKNLLMIKEHILAI antigen name:Erythrocyte binding antigen 175 host organism:Aotus nancymaae

    Publication: 15890273;

  8. Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

    ID: 1340337

    Description: epitope description:FTYIENKLDILNNSKPNKRW antigen name:Erythrocyte binding antigen 175 host organism:Aotus nancymaae

    Publication: 15890273;

  9. B- and T-cell responses in congenic mice to repeat sequences of the malaria antigen Pf332: effects of the number of repeats.

    ID: 1340410

    Description: epitope description:SVTEEIAEEDKSVTEEIAEEDK host organism:Mus musculus B10.BR

    Publication: 8088872;

  10. Antigenic analysis of the repeat domain of the circumsporozoite protein of Plasmodium vivax.

    ID: 1340414

    Description: epitope description:CYPKNPRENKLKQP antigen name:Circumsporozoite protein, putative host organism:Homo sapiens antibody name:G-6, 61-I

    Publication: 2442254;

  11. Genetic control of the immune response to a synthetic vaccine against Plasmodium falciparum.

    ID: 1340428

    Description: epitope description:CGDELEAETQNVYAAPNANPYSLFQKEKMVLPNANPPANKKNAGC host organism:Homo sapiens

    Publication: 1956698;

  12. Multiple antigen peptide. A novel approach to increase detection sensitivity of synthetic peptides in solid-phase immunoassays.

    ID: 1340438

    Description: epitope description:NANPNANPNANP antigen name:Circumsporozoite (CS) protein host organism:Mus musculus antibody name:2A10

    Publication: 2809228;

  13. Multiple antigen peptide. A novel approach to increase detection sensitivity of synthetic peptides in solid-phase immunoassays.

    ID: 1340440

    Description: epitope description:DPPPPNPNDPPPPNPN antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus antibody name:3D11

    Publication: 2809228;

  14. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340444

    Description: epitope description:ESYKNSKDKELLIYLNNGELKKKNS antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune sera

    Publication: 2409532;

  15. Rapid onset of malaria-induced mortality by immunizations with lipo-peptides: an experimental model to study deleterious immune responses and immunopa...

    ID: 1340449

    Description: epitope description:PPPPNPNDPPPPNPND antigen name:Circumsporozoite (CS) protein, putative host organism:Mus musculus

    Publication: 9041668;

  16. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340468

    Description: epitope description:YINNNNIPFQQKHNLPFPTDIDFDDHYIYVN antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus antibody name:monkey ser...

    Publication: 2409532;

  17. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340469

    Description: epitope description:YINNNNIPFQQKHNLPFPTDIDFDDHYIYVN antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune s...

    Publication: 2409532;

  18. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340478

    Description: epitope description:GIDKKKKKKNI antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human immune sera

    Publication: 2409532;

  19. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340482

    Description: epitope description:GAQILQTTLCARLLTARCGCVNLTADRMKRSFTLTC antigen name:Circumsporozoite (CS) protein host organism:Homo sapiens antibody name:human imm...

    Publication: 2409532;

  20. Characterisation of P. falciparum antigenic determinants isolated from a genomic expression library by differential antibody screening.

    ID: 1340490

    Description: epitope description:MNDIQIKTITIIYI antigen name:Circumsporozoite (CS) protein host organism:Saimiri sciureus antibody name:monkey serum

    Publication: 2409532;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston