Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549334

    Description: epitope description:SSATPVQQAQAA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  2. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549353

    Description: epitope description:LASSAPSTAVAQ antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  3. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1549362

    Description: epitope description:AAAVDTGSGGGG antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

  4. Neutralizing antibodies derived from the B cells of 1918 influenza pandemic survivors.

    ID: 1549459

    Description: epitope description:K180 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:2B12

    Publication: 18716625;

  5. Neutralizing antibodies derived from the B cells of 1918 influenza pandemic survivors.

    ID: 1549477

    Description: epitope description:P200 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:1F1

    Publication: 18716625;

  6. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549497

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  7. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549499

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  8. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549503

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  9. Characterization of the humoral response induced by a peptide corresponding to variable domain IV of the major outer membrane protein of Chlamydia tra...

    ID: 1549504

    Description: epitope description:SATAIFDTTTLNPTIAGAGDVKASAEGQLG antigen name:Major outer membrane porin, serovar D host organism:Mus musculus BALB/c

    Publication: 1639510;

  10. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549513

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston