Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. New neutralizing antibody epitopes in hepatitis C virus envelope glycoproteins are revealed by dissecting peptide recognition profiles.

    ID: 1907768

    Description: epitope description:DRDRSELSPLLLSTTQWQVL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22041300;

  2. New neutralizing antibody epitopes in hepatitis C virus envelope glycoproteins are revealed by dissecting peptide recognition profiles.

    ID: 1907771

    Description: epitope description:TTLPALSTGLIHLHQNIVDV antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22041300;

  3. Characterization of an isotype-dependent monoclonal antibody against linear neutralizing epitope effective for prophylaxis of enterovirus 71 infection...

    ID: 1907786

    Description: epitope description:RQEKD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mAb 51

    Publication: 22279543;

  4. Characterization of an isotype-dependent monoclonal antibody against linear neutralizing epitope effective for prophylaxis of enterovirus 71 infection...

    ID: 1907798

    Description: epitope description:KQEKD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mAb 51

    Publication: 22279543;

  5. Characterization of an isotype-dependent monoclonal antibody against linear neutralizing epitope effective for prophylaxis of enterovirus 71 infection...

    ID: 1907799

    Description: epitope description:KQEKD antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:mAb 51

    Publication: 22279543;

  6. New neutralizing antibody epitopes in hepatitis C virus envelope glycoproteins are revealed by dissecting peptide recognition profiles.

    ID: 1907806

    Description: epitope description:CSALYVGDLCGSVFLVGQLF antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22041300;

  7. New neutralizing antibody epitopes in hepatitis C virus envelope glycoproteins are revealed by dissecting peptide recognition profiles.

    ID: 1907810

    Description: epitope description:DRSGAPTYSWGANDTDVFVL antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22041300;

  8. Characterization of novel glycolipid antigens with an alpha-galactose epitope in lactobacilli detected with rabbit anti-Lactobacillus antisera and occ...

    ID: 1907815

    Description: epitope description:alpha-D-Glc-(1->2)-alpha-D-Glc-(1->3')-1,2-diacylglycerol host organism:Oryctolagus cuniculus Japanese white

    Publication: 21784785;

  9. New neutralizing antibody epitopes in hepatitis C virus envelope glycoproteins are revealed by dissecting peptide recognition profiles.

    ID: 1907827

    Description: epitope description:IVPAKSVCGPVYCFTPSPVV antigen name:Genome polyprotein host organism:Pan troglodytes

    Publication: 22041300;

  10. Rational development of high-affinity T-cell receptor-like antibodies.

    ID: 1863537

    Description: epitope description:SLLMWITQV host organism:Homo sapiens antibody name:3M4E5

    Publication: 19307587;

  11. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863781

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  12. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863784

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  13. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863787

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  14. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863788

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  15. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863789

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  16. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863796

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  17. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863803

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  18. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863804

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  19. Monoclonal antibodies to lipopolysaccharide antigens of Salmonella enterica serotype Typhimurium DT104.

    ID: 1863805

    Description: epitope description:2-O-acetyl-alpha-D-abequopyranosyl-(1->3)-alpha-D-mannopyranose antigen name:lipopolysaccharide host organism:Mus musculus BALB/c ...

    Publication: 21466285;

  20. Epitope characterization and crystal structure of GA101 provide insights into the molecular basis for type I/II distinction of CD20 antibodies.

    ID: 1863870

    Description: epitope description:ANPS antigen name:B-lymphocyte antigen CD20 host organism:Mus musculus BALB/c antibody name:Rituximab

    Publication: 21444918;

  21. Monoclonal antibodies against synthetic sequences of the nicotinic receptor cross-react fully with the native receptor and reveal the transmembrane di...

    ID: 1863970

    Description: epitope description:EESSNAAEEWKYVAMVIDHI antigen name:Acetylcholine receptor subunit alpha host organism:Mus musculus BALB/c

    Publication: 7678197;

  22. Vaccine and monoclonal antibody that enhance mouse resistance to candidiasis.

    ID: 1863975

    Description: epitope description:YGKDVKDLFDYAQE antigen name:Fructose-bisphosphate aldolase host organism:Oryctolagus cuniculus

    Publication: 21832099;

  23. Vaccine and monoclonal antibody that enhance mouse resistance to candidiasis.

    ID: 1863978

    Description: epitope description:YGKDVKDLFDYAQE antigen name:Fructose-bisphosphate aldolase host organism:Mus musculus BALB/c

    Publication: 21832099;

  24. Mimotope ELISA for detection of broad spectrum antibody against avian H5N1 influenza virus.

    ID: 1863991

    Description: epitope description:DTELTKQALRLV host organism:Mus musculus BALB/c antibody name:8H5

    Publication: 21912666;

  25. Mimotope ELISA for detection of broad spectrum antibody against avian H5N1 influenza virus.

    ID: 1863993

    Description: epitope description:DTPLTIAGLKLV host organism:Mus musculus BALB/c antibody name:8H5

    Publication: 21912666;

  26. Humoral immune response recognizes a complex set of epitopes on human papillomavirus type 6 l1 capsomers.

    ID: 1864015

    Description: epitope description:F49, R53, A54, S131, I132, K169, T172, P175, E262, T270, S276, G277, T280, G283, N289, T345, T346, S348 antigen name:Major capsid ...

    Publication: 16014913;

  27. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1864021

    Description: epitope description:E50, E89, E156, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IF1A7

    Publication: 21470570;

  28. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1864022

    Description: epitope description:E50, E89, E156, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IF1A7

    Publication: 21470570;

  29. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864050

    Description: epitope description:3beta-hydroxy-5alpha-cholestan-15-one host organism:Mus musculus C57BL/6

    Publication: 16341241;

  30. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864058

    Description: epitope description:5alpha-cholest-8(14)-en-3beta,15beta-diol host organism:Mus musculus C57BL/6

    Publication: 16341241;

  31. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864063

    Description: epitope description:2-O-glutaroyl-1-O-palmitoyl-sn-glycero-3-phosphocholine host organism:Mus musculus SJL

    Publication: 16341241;

  32. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864075

    Description: epitope description:1-acyl-sn-glycero-3-phosphoserine host organism:Homo sapiens

    Publication: 16341241;

  33. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864088

    Description: epitope description:MEVGWYRSPFSRVVHLYRNGK antigen name:Myelin-oligodendrocyte glycoprotein host organism:Mus musculus C57BL/6

    Publication: 16341241;

  34. A broadly neutralizing human monoclonal antibody that recognizes a conserved, novel epitope on the globular head of the influenza H1N1 virus hemagglut...

    ID: 1864105

    Description: epitope description:K147, A151, K236 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:5J8

    Publication: 21849447;

  35. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864116

    Description: epitope description:TPSTPA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  36. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864137

    Description: epitope description:DSSAHS antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  37. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864139

    Description: epitope description:DSSAHS antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus

    Publication: 11705983;

  38. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864147

    Description: epitope description:STPADS antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  39. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864156

    Description: epitope description:SAHSTP antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Mus musculus antibody name:anti-SAPA

    Publication: 11705983;

  40. Catalytic and biochemical features of a monoclonal antibody heavy chain, JN1-2, raised against a synthetic peptide with a hemagglutinin molecule of in...

    ID: 1864162

    Description: epitope description:TGLRNGITNKVNSVIEKAA host organism:Mus musculus BALB/c antibody name:JN1-1, JN1-2

    Publication: 21861493;

  41. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864168

    Description: epitope description:TPSTPA antigen name:Trans-sialidase, putative (UniProt:K4DNS9) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  42. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864176

    Description: epitope description:CQKAGGVAL host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  43. Multiple overlapping epitopes in the repetitive unit of the shed acute-phase antigen from Trypanosoma cruzi enhance its immunogenic properties.

    ID: 1864184

    Description: epitope description:CRWPDVLLWC host organism:Oryctolagus cuniculus New Zealand White

    Publication: 11705983;

  44. Universal influenza B vaccine based on the maturational cleavage site of the hemagglutinin precursor.

    ID: 1864214

    Description: epitope description:PAKLLKERGFFGAIAGFLE antigen name:Hemagglutinin host organism:Mus musculus BALB/c

    Publication: 15919893;

  45. Lipid microarrays identify key mediators of autoimmune brain inflammation.

    ID: 1864272

    Description: epitope description:HSLGKWLGHPDKF host organism:Mus musculus SJL

    Publication: 16341241;

  46. Hepatitis B virus surface antigen (HBsAg) as carrier for synthetic peptides having an attached hydrophobic tail.

    ID: 1864285

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2467197;

  47. Hepatitis B virus surface antigen (HBsAg) as carrier for synthetic peptides having an attached hydrophobic tail.

    ID: 1864288

    Description: epitope description:PNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAHC antigen name:Envelope glycoprotein gp160 host organism:Oryctolagus cuniculus

    Publication: 2467197;

  48. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864354

    Description: epitope description:MKKISSAILLTTFF antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  49. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864355

    Description: epitope description:MKKISSAILLTTFF antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  50. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864363

    Description: epitope description:FKSDPKKSDVKTYF antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston