Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Induction of feline leukaemia virus-neutralizing antibodies by immunization with synthetic peptides derived from the FeLV env gene.

    ID: 1549712

    Description: epitope description:RQSQTGSKVATQRPQTNESAPR antigen name:Env polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7692683;

  2. Induction of feline leukaemia virus-neutralizing antibodies by immunization with synthetic peptides derived from the FeLV env gene.

    ID: 1549721

    Description: epitope description:PTTMGPKRIGTGDRLINLVQGTYL antigen name:Env polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7692683;

  3. Induction of feline leukaemia virus-neutralizing antibodies by immunization with synthetic peptides derived from the FeLV env gene.

    ID: 1549725

    Description: epitope description:PTTMGPKRIGTGDRLINLVQGTYL antigen name:Env polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7692683;

  4. Induction of feline leukaemia virus-neutralizing antibodies by immunization with synthetic peptides derived from the FeLV env gene.

    ID: 1549736

    Description: epitope description:ATQRPQTNESAPRSVAPTTMGPKRIGTGDRLINLVQGTYL antigen name:Env polyprotein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7692683;

  5. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549757

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  6. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549759

    Description: epitope description:GGTEESVVTASRS antigen name:Other Taenia saginata (beef tapeworm) protein host organism:Homo sapiens

    Publication: 15916786;

  7. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549763

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  8. Oncospheral peptide-based ELISAs as potential seroepidemiological tools for Taenia solium cysticercosis/neurocysticercosis in Venezuela.

    ID: 1549766

    Description: epitope description:RDPSKMRDIDRHHEYNVREGND antigen name:Myosin-like protein host organism:Homo sapiens

    Publication: 15916786;

  9. Immunogenic B-cell epitopes of Babesia bovis rhoptry-associated protein 1 are distinct from sequences conserved between species.

    ID: 1549771

    Description: epitope description:PTKEFFREA antigen name:Rhoptry-associated protein 1 (RAP-1) host organism:Mus musculus BALB/c antibody name:BABB75, MBOC79

    Publication: 7687587;

  10. A novel mimetic antigen eliciting protective antibody to Neisseria meningitidis.

    ID: 1549810

    Description: epitope description:AHFVQQTP antigen name:Major outer membrane protein P.IA host organism:Mus musculus CD1 antibody name:mAb 25

    Publication: 11714816;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston