Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864364

    Description: epitope description:KKSDVKTYFTTVAA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  2. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864365

    Description: epitope description:KKSDVKTYFTTVAA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  3. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864372

    Description: epitope description:TDLNSLPKEKSDIS antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  4. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864375

    Description: epitope description:LPKEKSDISSTTGK antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  5. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864376

    Description: epitope description:SAILLTTFFVFINC antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  6. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864377

    Description: epitope description:SAILLTTFFVFINC antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  7. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864383

    Description: epitope description:DSTGSVGTAVEGAI antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  8. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864384

    Description: epitope description:VGTAVEGAIKEVSE antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  9. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864385

    Description: epitope description:VGTAVEGAIKEVSE antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  10. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864387

    Description: epitope description:EGAIKEVSELLDKL antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  11. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864399

    Description: epitope description:TTFFVFINCKSQVA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  12. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864404

    Description: epitope description:AKVADKASVKGIAK antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  13. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864427

    Description: epitope description:GAAAHGDSEAASKA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  14. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864432

    Description: epitope description:GAVSAVSGEQILSA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  15. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864434

    Description: epitope description:VSGEQILSAIVTAA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  16. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864443

    Description: epitope description:SQVADKDDPTNKFY antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  17. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864444

    Description: epitope description:GKKPEEAKNPIAAA antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  18. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864446

    Description: epitope description:EAKNPIAAAIGDKD antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  19. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864455

    Description: epitope description:QDEMKKDDQIAAAI antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  20. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864456

    Description: epitope description:KDDQIAAAIALRGM antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  21. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864468

    Description: epitope description:EKEKAEGAIKGAAE antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  22. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864469

    Description: epitope description:EKEKAEGAIKGAAE antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  23. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864472

    Description: epitope description:GAAESAVRKVLGAI antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  24. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864478

    Description: epitope description:GLIGDAVSSGLRKV antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  25. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864480

    Description: epitope description:AVSSGLRKVGDSVK antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  26. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864485

    Description: epitope description:DSVKAASKETPPAL antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  27. Epitope mapping of antibodies to VlsE protein of Borrelia burgdorferi in post-Lyme disease syndrome.

    ID: 1864489

    Description: epitope description:VKAASKETPPALNK antigen name:Outer surface protein VlsE1 host organism:Homo sapiens

    Publication: 21778118;

  28. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864509

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus

    Publication: 21944756;

  29. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864510

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus

    Publication: 21944756;

  30. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864514

    Description: epitope description:2,4-dinitrophenyl group host organism:Mus musculus

    Publication: 21944756;

  31. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864561

    Description: epitope description:N(2)-{[2-(2-{[4-(indol-3-yl)butanoyl]amino}ethoxy)ethoxy]acetyl}arginyl-N(1)-{2-[(5-sulfo-1-naphthyl)amino]ethyl}aspartamide host ...

    Publication: 21944756;

  32. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864583

    Description: epitope description:N-{1-amino-6-[(5-nitro-2-furoyl)amino]-1-oxohexan-2-yl}-26-(indol-3-yl)-23-oxo-4,7,10,13,16,19-hexaoxa-22-azahexacosan-1-amide hos...

    Publication: 21944756;

  33. Coronaviral hypothetical and structural proteins were found in the intestinal surface enterocytes and pneumocytes of severe acute respiratory syndrome...

    ID: 1864687

    Description: epitope description:VVNIQKEIDRLNEV antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus

    Publication: 15920543;

  34. Coronaviral hypothetical and structural proteins were found in the intestinal surface enterocytes and pneumocytes of severe acute respiratory syndrome...

    ID: 1864689

    Description: epitope description:SQILPDPLKPTKRSF antigen name:Spike glycoprotein host organism:Oryctolagus cuniculus

    Publication: 15920543;

  35. Hepatitis B virus surface antigen (HBsAg) as carrier for synthetic peptides having an attached hydrophobic tail.

    ID: 1864746

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Mus musculus SJL

    Publication: 2467197;

  36. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864801

    Description: epitope description:N(6)-(N(6)-{6-[(5-nitro-2-furoyl)amino]hexanoyl}lysyl)lysyl-N(6)-[4-(indol-3-yl)butanoyl]lysinamide host organism:Mus musculus

    Publication: 21944756;

  37. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864803

    Description: epitope description:N(6)-[N(6)-(N(6)-{6-[(5-nitro-2-furoyl)amino]hexanoyl}lysyl)lysyl]lysyl-N(6)-[4-(indol-3-yl)butanoyl]lysinamide host organism:Mus ...

    Publication: 21944756;

  38. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864805

    Description: epitope description:N(2)-{3-[2-(2-{[(1-{N-[(1-{3-[2-(2-{[4-(indol-3-yl)butanoyl]amino}ethoxy)ethoxy]propanoyl}piperidin-4-yl)carbonyl]glycyl}piperidin...

    Publication: 21944756;

  39. Design of a heterobivalent ligand to inhibit IgE clustering on mast cells.

    ID: 1864807

    Description: epitope description:N-(18-amino-18-oxo-3,6,9,12,15-pentaoxaoctadec-1-yl)-N(2)-{3-[2-(2-{[(1-{[1-({1-[(1-{3-[2-(2-{[4-(indol-3-yl)butanoyl]amino}ethoxy...

    Publication: 21944756;

  40. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1864822

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  41. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1864825

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  42. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885001

    Description: epitope description:P336, M340, H346 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-87 and DV2-104

    Publication: 20592088;

  43. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885007

    Description: epitope description:W101, L107 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-52

    Publication: 20592088;

  44. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885013

    Description: epitope description:K88, Q233 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-44

    Publication: 20592088;

  45. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885015

    Description: epitope description:K88, Q233 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-44

    Publication: 20592088;

  46. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885025

    Description: epitope description:T55, E71, L107, H244 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-30

    Publication: 20592088;

  47. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2.

    ID: 1885031

    Description: epitope description:T55, E71, K88, E184, Q233 antigen name:Genome polyprotein host organism:Mus musculus C57BL/6 antibody name:DV2-58

    Publication: 20592088;

  48. Immunogenic peptides from phage display libraries with potential of protecting mice against the Pseudorabies virus.

    ID: 1885133

    Description: epitope description:SVTKLGDPRAPR host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21764227;

  49. Immunogenic peptides from phage display libraries with potential of protecting mice against the Pseudorabies virus.

    ID: 1885138

    Description: epitope description:KPGDPRS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21764227;

  50. Immunogenic peptides from phage display libraries with potential of protecting mice against the Pseudorabies virus.

    ID: 1885142

    Description: epitope description:KVGDPLW host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21764227;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston