Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "
  1. Neutralizing antibodies derived from the B cells of 1918 influenza pandemic survivors.

    ID: 1551142

    Description: epitope description:P200 antigen name:Hemagglutinin host organism:Homo sapiens

    Publication: 18716625;
  2. Immunogenicity and protective immunity induced by synthetic peptides associated with a catalytic subdomain of mutans group streptococcal glucosyltrans...

    ID: 1551150

    Description: epitope description:ANDVDNSNPVVQ antigen name:UniProt:I6TY13 host organism:Rattus norvegicus Sprague-Dawley antibody name:anti-SAND

    Publication: 9353015;
  3. Immunogenicity and protective immunity induced by synthetic peptides associated with a catalytic subdomain of mutans group streptococcal glucosyltrans...

    ID: 1551151

    Description: epitope description:ANDVDNSNPVVQ antigen name:UniProt:I6TY13 host organism:Rattus norvegicus Sprague-Dawley antibody name:anti-SAND

    Publication: 9353015;
  4. Identification of a surface-exposed immunodominant epitope on outer membrane protein P1 of Haemophilus influenzae type b.

    ID: 1551162

    Description: epitope description:YLKGKKVHFKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Mus musculus BALB/c antibody n...

    Publication: 1705245;
  5. Mapping of bactericidal epitopes on the P2 porin protein of nontypeable Haemophilus influenzae.

    ID: 1551231

    Description: epitope description:TQKIPKANAADADTDTT antigen name:Other Haemophilus influenzae protein host organism:Mus musculus BALB/c antibody name:6G3, 1B5, 6D2,...

    Publication: 7520420;
  6. Mapping of bactericidal epitopes on the P2 porin protein of nontypeable Haemophilus influenzae.

    ID: 1551236

    Description: epitope description:TQKIPKANAADADTDTT antigen name:Other Haemophilus influenzae protein host organism:Mus musculus BALB/c antibody name:6G3, 1B5, 6D2,...

    Publication: 7520420;
  7. Mapping of bactericidal epitopes on the P2 porin protein of nontypeable Haemophilus influenzae.

    ID: 1551237

    Description: epitope description:SRTRTTSVGDKQVASKV antigen name:Other Haemophilus influenzae protein host organism:Mus musculus BALB/c antibody name:5F2

    Publication: 7520420;
  8. Induction of feline leukaemia virus-neutralizing antibodies by immunization with synthetic peptides derived from the FeLV env gene.

    ID: 1551311

    Description: epitope description:RQSQTGSKVATQRPQTNESAPR antigen name:Env polyprotein host organism:Felis catus

    Publication: 7692683;
  9. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1551319

    Description: epitope description:RQRASVAGAGAH antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;
  10. Localization and diagnostic application of immunodominant domains of the BFRF3-encoded Epstein-Barr virus capsid protein.

    ID: 1551320

    Description: epitope description:QRASVAGAGAHA antigen name:Capsid protein VP26 host organism:Homo sapiens

    Publication: 8014488;

Displaying 10 of 1,510,353 results for " "