Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906567

    Description: epitope description:KYSIDVESFDKLYKSLMFG antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  2. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906570

    Description: epitope description:PPVKIKNLLDNEIYTIEEG antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  3. Molecular immune recognition of botulinum neurotoxin B. The light chain regions that bind human blocking antibodies from toxin-treated cervical dyston...

    ID: 1906573

    Description: epitope description:YEEISKEHLAVYKIQMCKS antigen name:Botulinum neurotoxin type B host organism:Homo sapiens

    Publication: 21962573;

  4. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906756

    Description: epitope description:N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR2A

    Publication: 18064037;

  5. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906759

    Description: epitope description:S424, H488, G523, P525, D535, V538, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3C

    Publication: 18064037;

  6. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906777

    Description: epitope description:Q412, T416, G418, N423, S424, G523, P525, G530, D535, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody nam...

    Publication: 18064037;

  7. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906779

    Description: epitope description:Q412, S424, G523, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3D

    Publication: 18064037;

  8. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906800

    Description: epitope description:Q412, W420, N423, R483, P484, Y485, G523, P525, T526, G530, T534, N540, P544, P545, G547, W549 antigen name:Genome polyprotein hos...

    Publication: 18064037;

  9. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906801

    Description: epitope description:Q412, W420, N423, R483, P484, Y485, G523, P525, T526, G530, T534, N540, P544, P545, G547, W549 antigen name:Genome polyprotein hos...

    Publication: 18064037;

  10. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906802

    Description: epitope description:N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR2A

    Publication: 18064037;

  11. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906822

    Description: epitope description:Q412, T416, G418, N423, S424, G523, P525, G530, D535, N540 antigen name:Genome polyprotein host organism:Homo sapiens antibody nam...

    Publication: 18064037;

  12. Broadly neutralizing antibodies protect against hepatitis C virus quasispecies challenge.

    ID: 1906841

    Description: epitope description:Q412, S424, G523, D535 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:AR3D

    Publication: 18064037;

  13. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865026

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  14. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865056

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  15. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865059

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  16. Rat monoclonal antibodies against Aspergillus galactomannan.

    ID: 1865061

    Description: epitope description:beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf-(1->5)-beta-D-Galf antigen name:galactomannan host organism:Rattus norvegicus LO...

    Publication: 1375195;

  17. Spot synthesis of overlapping peptides on paper membrane supports enables the identification of linear monoclonal antibody binding determinants on mor...

    ID: 1865094

    Description: epitope description:ELFSEIQEIR antigen name:phosphoprotein host organism:Mus musculus C57BL/6 antibody name:PD/Px5

    Publication: 8588324;

  18. Spot synthesis of overlapping peptides on paper membrane supports enables the identification of linear monoclonal antibody binding determinants on mor...

    ID: 1865099

    Description: epitope description:ENP antigen name:phosphoprotein host organism:Mus musculus BALB/c antibody name:3.768

    Publication: 8588324;

  19. Antibody recognition of a unique tumor-specific glycopeptide antigen.

    ID: 1865107

    Description: epitope description:ERGTKPPLEELS + GAL(T4) antigen name:Podoplanin (UniProt:Q62011) host organism:Mus musculus C3H/He antibody name:237mAb

    Publication: 20479270;

  20. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1865138

    Description: epitope description:ADLGDFENSAAAAETGVGVIKSIA antigen name:UniProt:A5F392 host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  21. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1865201

    Description: epitope description:AATGAGVIKSIAPGSANLNLTNITH antigen name:Toxin coregulated pilin host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  22. Species-specific B-cell epitope on the C-terminal region of the alpha antigen from Mycobacterium intracellulare in mice.

    ID: 1865388

    Description: epitope description:LQSALGASSGGGG antigen name:Antigen 85-B host organism:Mus musculus BALB/c

    Publication: 10068124;

  23. Species-specific B-cell epitope on the C-terminal region of the alpha antigen from Mycobacterium intracellulare in mice.

    ID: 1865389

    Description: epitope description:LQSALGASSGGGG antigen name:Antigen 85-B host organism:Mus musculus BALB/c

    Publication: 10068124;

  24. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1865403

    Description: epitope description:E50, E89, E156, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IF1A7

    Publication: 21470570;

  25. Neutralization escape variant of West Nile virus associated with altered peripheral pathogenicity and differential cytokine profile.

    ID: 1865412

    Description: epitope description:E50, E89, E242 antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:IVC3FG10

    Publication: 21470570;

  26. The specificity of allergic reactions. VI. Unresponsiveness to simple chemicals.

    ID: 1865509

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Hartley

    Publication: 14021926;

  27. The specificity of allergic reactions. VI. Unresponsiveness to simple chemicals.

    ID: 1865512

    Description: epitope description:2,4-dinitrophenyl group host organism:Cavia porcellus Hartley

    Publication: 14021926;

  28. Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes ...

    ID: 1865602

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDGEHVSGSPDVTAGGFV antigen name:UniProt:A5VUA5 host organism:Mus musculus BALB/c antibody name:A01/08H06/G02

    Publication: 11598077;

  29. Minor nucleotide substitutions in the omp31 gene of Brucella ovis result in antigenic differences in the major outer membrane protein that it encodes ...

    ID: 1865605

    Description: epitope description:NAGYAGGKFKHPFSSFDKEDGEHVSGSPDVTAGGFV antigen name:UniProt:A5VUA5 host organism:Mus musculus BALB/c antibody name:A01/08H06/G02

    Publication: 11598077;

  30. Identification of one critical amino acid that determines a conformational neutralizing epitope in the capsid protein of porcine circovirus type 2.

    ID: 1865611

    Description: epitope description:A59 antigen name:Capsid protein host organism:Mus musculus BALB/c antibody name:8E4

    Publication: 21859462;

  31. Developing subunit immunogens using B and T cell epitopes and their constructs derived from the F1 antigen of Yersinia pestis using novel delivery veh...

    ID: 1865652

    Description: epitope description:TGSQDFFVRSIG antigen name:F1 capsule antigen host organism:Mus musculus FVB/J antibody name:Serum

    Publication: 14522457;

  32. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865706

    Description: epitope description:LFIG antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:5B5

    Publication: 12180984;

  33. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865709

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  34. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865710

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  35. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865712

    Description: epitope description:RVNQVAEVLQL antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4H12

    Publication: 12180984;

  36. Functional characterization of the maltose ATP-binding-cassette transporter of Salmonella typhimurium by means of monoclonal antibodies directed again...

    ID: 1865725

    Description: epitope description:LFREDGSACR antigen name:Maltose/maltodextrin import ATP-binding protein MalK host organism:Mus musculus BALB/c antibody name:4B3

    Publication: 12180984;

  37. Structural basis for EGF receptor inhibition by the therapeutic antibody IMC-11F8.

    ID: 1865850

    Description: epitope description:P373, R377, Q408, Q432, H433, S442, S464, K467, K489, I491, S492, N497 antigen name:Epidermal growth factor receptor host organism...

    Publication: 18275813;

  38. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866024

    Description: epitope description:V102, L229 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ13

    Publication: 21744000;

  39. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866037

    Description: epitope description:V102 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ04

    Publication: 21744000;

  40. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866042

    Description: epitope description:A76, I203 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH02

    Publication: 21744000;

  41. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866043

    Description: epitope description:A76, I203 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH02

    Publication: 21744000;

  42. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866052

    Description: epitope description:AETGVGVIKSIAPASKNLDLTNITH antigen name:UniProt:A5F392 host organism:Mus musculus BALB.B

    Publication: 11705949;

  43. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866058

    Description: epitope description:NNAYP antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:QH05

    Publication: 21744000;

  44. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866064

    Description: epitope description:ADLGDFETSVADAATGAGVIKSIA antigen name:Toxin coregulated pilin host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  45. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866066

    Description: epitope description:AATGAGVIKSIAPGSANLNLTNITH antigen name:Toxin coregulated pilin host organism:Mus musculus B10.D2-Hc1 H2d H2-T18c/nSn

    Publication: 11705949;

  46. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866077

    Description: epitope description:LDLTNITHVEKLCKGTAPFGVAFGNS antigen name:UniProt:A5F392 host organism:Mus musculus B10.A-H2a H2-T18a/SgSnJ

    Publication: 11705949;

  47. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866078

    Description: epitope description:LNLTNITHVEKLCTGTAPFTVAFGNS antigen name:Toxin coregulated pilin host organism:Mus musculus B10.D2-Hc1 H2d H2-T18c/nSn

    Publication: 11705949;

  48. Immune response genes modulate serologic responses to Vibrio cholerae TcpA pilin peptides.

    ID: 1866079

    Description: epitope description:LNLTNITHVEKLCTGTAPFTVAFGNS antigen name:Toxin coregulated pilin host organism:Mus musculus B10.BR-H2k H2-T18a/SgSnJ

    Publication: 11705949;

  49. Identification of amino acids in highly pathogenic avian influenza H5N1 virus hemagglutinin that determine avian influenza species specificity.

    ID: 1866089

    Description: epitope description:V102, T172 antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:XJ15

    Publication: 21744000;

  50. Mapping IgE binding epitopes of major shrimp (Penaeus monodon) allergen with immunoinformatics tools.

    ID: 1866161

    Description: epitope description:DTLEQQNKEANNRAEKSE antigen name:Pen m 1 host organism:Homo sapiens

    Publication: 21802470;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston