Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435459

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  2. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435467

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  3. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435470

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  4. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435473

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  5. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435474

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  6. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435478

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  7. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435485

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  8. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis.

    ID: 1435489

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;

  9. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein.

    ID: 1435504

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...

    Publication: 7506298;

  10. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435518

    Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;

  11. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435522

    Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;

  12. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435535

    Description: epitope description:HLLRLSEI host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;

  13. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435537

    Description: epitope description:HLLRLSEI host organism:Mus musculus DBA/2 antibody name:152-66-9B

    Publication: 11122460;

  14. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435540

    Description: epitope description:SLLTYMKM host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;

  15. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435545

    Description: epitope description:YLLQKLRN host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;

  16. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization.

    ID: 1435549

    Description: epitope description:YLLQKLRN host organism:Mus musculus CD1 antibody name:Infected mouse sera

    Publication: 11122460;

  17. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection.

    ID: 1435551

    Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Mus musculus antibody name:L2

    Publication: 16517852;

  18. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection.

    ID: 1435558

    Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Homo sapiens

    Publication: 16517852;

  19. Characterization of the Borna disease virus phosphoprotein, p23.

    ID: 1435575

    Description: epitope description:PSSLVDSL antigen name:Phosphoprotein host organism:Rattus norvegicus

    Publication: 8892940;

  20. Characterization of the Borna disease virus phosphoprotein, p23.

    ID: 1435588

    Description: epitope description:PMLPSHPA antigen name:Phosphoprotein host organism:Rattus norvegicus

    Publication: 8892940;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston