Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Immunization with a peptide derived from the G glycoprotein of bovine respiratory syncytial virus (BRSV) reduces the incidence of BRSV-associated pneu...

    ID: 1460307

    Description: epitope description:STCEGNLACLSLSK host organism:Mus musculus BALB/c antibody name:Mouse sera

    Publication: 9302749;

  2. Peptide mimics elicit antibody responses against the outer-membrane lipooligosaccharide of group B neisseria meningitidis.

    ID: 1460348

    Description: epitope description:SMYGSYN host organism:Mus musculus antibody name:9-2-L379

    Publication: 11004398;

  3. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460372

    Description: epitope description:LFPKVAPQAISSVENIEGNGGPGTIKKISF antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  4. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1460374

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  5. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus.

    ID: 1460385

    Description: epitope description:CCRHKQPLIAPAKQLLPPSASARRGDLAHLAAAHARHPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  6. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460400

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Oryctolagus cuniculus

    Publication: 15479266;

  7. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460402

    Description: epitope description:DGGSILKISNKYHTKGDHEVKAEQVKASKE antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  8. Non-anaphylactic surface-exposed peptides of the major birch pollen allergen, Bet v 1, for preventive vaccination.

    ID: 1460405

    Description: epitope description:KAEQVKASKEMGETLLRAVESYLLAHSDAYN antigen name:Bet v 1 host organism:Homo sapiens

    Publication: 15479266;

  9. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460794

    Description: epitope description:KNESKYSNTFINNAYNMSIRRSM antigen name:Merozoite surface antigen 2 host organism:Mus musculus BALB/c

    Publication: 17548134;

  10. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460804

    Description: epitope description:KKICKMEKCSSVFNV antigen name:Circumsporozoite (CS) protein host organism:Mus musculus BALB/c

    Publication: 17548134;

  11. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460806

    Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Mus musculus BALB/c

    Publication: 17548134;

  12. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460807

    Description: epitope description:EDSGSNGKKITCECTKPDS antigen name:Merozoite surface protein 1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 17548134;

  13. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460808

    Description: epitope description:DGNCEDIPHVNEFSAIDL antigen name:Apical membrane antigen 1 host organism:Mus musculus BALB/c

    Publication: 17548134;

  14. Immunogenicity and in vitro protective efficacy of a polyepitope Plasmodium falciparum candidate vaccine constructed by epitope shuffling.

    ID: 1460812

    Description: epitope description:QTDEIKNDNIQTDEIKNDNI antigen name:Ag-1 blood stage membrane protein homologue host organism:Mus musculus BALB/c

    Publication: 17548134;

  15. Isolation of recombinant fragments of the major outer-membrane protein of Chlamydia trachomatis: their potential as subunit vaccines.

    ID: 1460850

    Description: epitope description:NPAYGRHMQD antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop antibody name:As1

    Publication: 1702826;

  16. Isolation of recombinant fragments of the major outer-membrane protein of Chlamydia trachomatis: their potential as subunit vaccines.

    ID: 1460851

    Description: epitope description:RHMQDAEMFT antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop antibody name:As1

    Publication: 1702826;

  17. Delineation of protective epitopes on the E2-envelope glycoprotein of Semliki Forest virus.

    ID: 1460870

    Description: epitope description:SQLTTEGKPHGW antigen name:Structural polyprotein host organism:Mus musculus ICR antibody name:Mouse sera

    Publication: 1716035;

  18. Identification of a dengue virus type 2 (DEN-2) serotype-specific B-cell epitope and detection of DEN-2-immunized animal serum samples using an epitop...

    ID: 1460897

    Description: epitope description:SHRLHNTMPSES host organism:Mus musculus BALB/c

    Publication: 13679612;

  19. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 1460919

    Description: epitope description:R429 antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:MAbs 19 and 20

    Publication: 1383404;

  20. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 1460931

    Description: epitope description:S190, L258, K272 antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:7C2

    Publication: 1383404;

  21. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 1460932

    Description: epitope description:S190, L258, K272 antigen name:Fusion glycoprotein F0 host organism:Mus musculus antibody name:7C2

    Publication: 1383404;

  22. Isolation of recombinant fragments of the major outer-membrane protein of Chlamydia trachomatis: their potential as subunit vaccines.

    ID: 1460998

    Description: epitope description:TAIFDTTTLN antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop antibody name:As1...

    Publication: 1702826;

  23. Isolation of recombinant fragments of the major outer-membrane protein of Chlamydia trachomatis: their potential as subunit vaccines.

    ID: 1460999

    Description: epitope description:TTTLNPTIAG antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop antibody name:As1...

    Publication: 1702826;

  24. Isolation of recombinant fragments of the major outer-membrane protein of Chlamydia trachomatis: their potential as subunit vaccines.

    ID: 1461001

    Description: epitope description:AGEVKANAEG antigen name:Major outer membrane porin, serovar D host organism:Oryctolagus cuniculus Sandy Half-Lop antibody name:As1

    Publication: 1702826;

  25. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory...

    ID: 1461053

    Description: epitope description:N216, N262, N268, K272 antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/c antibody name:47F, AK13A2

    Publication: 1383404;

  26. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461218

    Description: epitope description:SKPTTKQRQNKPPSK antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV1293 antisera

    Publication: 3476962;

  27. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461220

    Description: epitope description:SKPTTKQRQNKPPSK antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:CH18537 antisera

    Publication: 3476962;

  28. A B cell-, T cell-linked epitope located on the adhesin of Mycoplasma pneumoniae.

    ID: 1461285

    Description: epitope description:ITAPQTSAGSSSGISTNTSG antigen name:Adhesin P1 host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 1695202;

  29. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461296

    Description: epitope description:EYPSQPSSPPNTPRQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV4843 antisera

    Publication: 3476962;

  30. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461300

    Description: epitope description:PSPSQVSTTSEYPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV3212 antisera

    Publication: 3476962;

  31. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461304

    Description: epitope description:PSPSQVSTTSEYPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV1293 antisera

    Publication: 3476962;

  32. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461305

    Description: epitope description:PSPSQVSTTSEYPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV9894 antisera

    Publication: 3476962;

  33. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461307

    Description: epitope description:PSPSQVSTTSEYPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV6873 antisera

    Publication: 3476962;

  34. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461313

    Description: epitope description:TFHSTSSEGNPSPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:A2 antisera

    Publication: 3476962;

  35. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461315

    Description: epitope description:TFHSTSSEGNPSPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:CH18537 antisera

    Publication: 3476962;

  36. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461317

    Description: epitope description:TFHSTSSEGNPSPSQ antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV3212 antisera

    Publication: 3476962;

  37. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461321

    Description: epitope description:GNPELTSQMETFHST antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV1293 antisera

    Publication: 3476962;

  38. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461322

    Description: epitope description:GNPELTSQMETFHST antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:CH18537 antisera

    Publication: 3476962;

  39. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461328

    Description: epitope description:ITTLLTSNTTGNPEL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV12138 antisera

    Publication: 3476962;

  40. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461329

    Description: epitope description:ITTLLTSNTTGNPEL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV4843 antisera

    Publication: 3476962;

  41. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461336

    Description: epitope description:PTINTTKTNIITTLL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV12138 antisera

    Publication: 3476962;

  42. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461340

    Description: epitope description:PTINTTKTNIITTLL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV9894 antisera

    Publication: 3476962;

  43. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461341

    Description: epitope description:PTINTTKTNIITTLL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV4843 antisera

    Publication: 3476962;

  44. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461359

    Description: epitope description:NPKPQTTKSKEVPTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV9894 antisera

    Publication: 3476962;

  45. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461373

    Description: epitope description:PGKKTTTKPTKKPTL antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV1293 antisera

    Publication: 3476962;

  46. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461389

    Description: epitope description:HFEVFNFVPCSICSN antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV12138 antisera

    Publication: 3476962;

  47. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461393

    Description: epitope description:KPPSKPNNDFHFEVF antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:A2 antisera

    Publication: 3476962;

  48. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461400

    Description: epitope description:KNTTTTQTQPSKPTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV6873 antisera

    Publication: 3476962;

  49. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461415

    Description: epitope description:STLQSTTVKTKNTTT antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV12138 antisera

    Publication: 3476962;

  50. Site-directed serology with synthetic peptides representing the large glycoprotein G of respiratory syncytial virus.

    ID: 1461426

    Description: epitope description:ILASTTPGVKSTLQS antigen name:Major surface glycoprotein G host organism:Oryctolagus cuniculus antibody name:WV6873 antisera

    Publication: 3476962;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston