Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954794

    Description: epitope description:RIEWNGMSNYYNKIYR antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  2. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954795

    Description: epitope description:NYYNKIYRKSNKESED antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Homo sapiens

    Publication: 22970138;

  3. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954817

    Description: epitope description:VAEREAYYLWKQYNPTGKGIDDANKKAC antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus ...

    Publication: 22970138;

  4. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954819

    Description: epitope description:VAEREAYYLWKQYHAHNDTTYLAHK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus Wis...

    Publication: 22970138;

  5. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954822

    Description: epitope description:VAEREAYYLWKQYHAHNDTTYLAHK antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus Wis...

    Publication: 22970138;

  6. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954828

    Description: epitope description:VGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANI antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  7. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954829

    Description: epitope description:VRNSWDTNWGDNGYGYFAANIDLMMIEEYPYVVIL antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  8. Identification and characterization of B-cell epitopes in the DBL4ε domain of VAR2CSA.

    ID: 1954839

    Description: epitope description:VAEREAYYLWKQYNPTGKGIDDANKKAC antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I639) host organism:Rattus norvegicus ...

    Publication: 22970138;

  9. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954845

    Description: epitope description:KDLDAFRHYDGRTIIQRDNGYQPNYHAVNIV antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  10. Hypoallergenic Der p 1/Der p 2 combination vaccines for immunotherapy of house dust mite allergy.

    ID: 1954846

    Description: epitope description:GRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus

    Publication: 22789398;

  11. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954865

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  12. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954875

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  13. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954877

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  14. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954878

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  15. Highly pathogenic porcine reproductive and respiratory syndrome virus GP5 B antigenic region is not a neutralizing antigenic region.

    ID: 1954888

    Description: epitope description:SHFQLIYNL antigen name:Glycoprotein 5 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22771210;

  16. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954901

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  17. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954905

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  18. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954906

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  19. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954907

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  20. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954909

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  21. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954926

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  22. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954929

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  23. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954942

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  24. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954943

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  25. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954945

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  26. Highly conserved protective epitopes on influenza B viruses.

    ID: 1954959

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  27. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955029

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  28. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955030

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  29. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955032

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  30. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955035

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  31. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955036

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  32. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955065

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  33. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955067

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  34. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955094

    Description: epitope description:T52, K53, Y55, F56, K67, L73, N74, C75, T76, D77, H100, E101, V105, G299, S300, L301, P302, I304 antigen name:Hemagglutinin host o...

    Publication: 22878502;

  35. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955126

    Description: epitope description:P176 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:CR8033

    Publication: 22878502;

  36. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955136

    Description: epitope description:P176 antigen name:Hemagglutinin host organism:Homo sapiens antibody name:CR8033

    Publication: 22878502;

  37. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955141

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  38. Highly conserved protective epitopes on influenza B viruses.

    ID: 1955142

    Description: epitope description:A: H44, Q46, D47, I48, S304, M305, P306; B: V364, D365, G366, W367, A382, K384, T387, Q388, I391, D392, V394, T395, V398, I402 ant...

    Publication: 22878502;

  39. Selective neutralization of APP-C99 with monoclonal antibodies reduces the production of Alzheimer's Abeta peptides.

    ID: 1955220

    Description: epitope description:DAEFRHD antigen name:Amyloid beta A4 protein host organism:Mus musculus BALB/c antibody name:mC99(1-7)

    Publication: 22317957;

  40. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955231

    Description: epitope description:PGPNITATYG antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  41. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955233

    Description: epitope description:TATYGSKWLE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  42. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955239

    Description: epitope description:YGSNPRGAAP antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  43. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955247

    Description: epitope description:DVDKPPFDGM antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  44. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955254

    Description: epitope description:DGLGCRACYE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  45. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955259

    Description: epitope description:IKCKEPVECS antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  46. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955262

    Description: epitope description:GEPVLVKITD antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  47. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955276

    Description: epitope description:QEDKLRKAGE antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  48. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955286

    Description: epitope description:TKITFHIEKG antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  49. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955291

    Description: epitope description:SNDHYLALLV antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;

  50. Mapping of IgE and IgG4 antibody-binding epitopes in Cyn d 1, the major allergen of Bermuda grass pollen.

    ID: 1955295

    Description: epitope description:KYAAGDGNIV antigen name:Cyn d 1 host organism:Homo sapiens

    Publication: 21985791;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston