Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.

    ID: 1511686

    Description: epitope description:Y2, P154, Y155, W203, P204, G205, D206, K208, K243, S245, E246, F248, G249, E282, G285, P288, R291 antigen name:Pancreatic alpha-a...

    Publication: 11960990;

  2. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511751

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  3. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511753

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  4. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511758

    Description: epitope description:A392 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-10C

    Publication: 1701477;

  5. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511764

    Description: epitope description:S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-2A, KU-7E, KU10H

    Publication: 1701477;

  6. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511769

    Description: epitope description:AATTVNGGTVHFK antigen name:Type-1 fimbrial protein, A chain host organism:Oryctolagus cuniculus

    Publication: 9276729;

  7. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511776

    Description: epitope description:CKTANGTAIPIGGGSANVYVNLAPV antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  8. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511781

    Description: epitope description:NYARTGGQVTAG antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  9. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1511784

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  10. Autoantibodies to the HLA-B27 sequence cross-react with the hypothetical peptide from the arthritis-associated Shigella plasmid.

    ID: 1511797

    Description: epitope description:AKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Oryctolagus cuniculus antibod...

    Publication: 2212008;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston