Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. Molecular recognition of Candida albicans (1->2)-beta-mannan oligosaccharides by a protective monoclonal antibody reveals the immunodominance of inter...

    ID: 1952715

    Description: epitope description:beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl-(1->2)-beta-D-mannopyranosyl group antigen name:(1->2)-beta-D-mannan host organ...

    Publication: 22493450;

  2. Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.

    ID: 1952718

    Description: epitope description:KYTQQSTAIRGDRAVLAAKYANTKRKLPSTFNFGYVTADK antigen name:Polyprotein host organism:Gallus gallus antibody name:scFv2

    Publication: 22698877;

  3. Mapping of antigenic determinants on a SAT2 foot-and-mouth disease virus using chicken single-chain antibody fragments.

    ID: 1952719

    Description: epitope description:KYTQQSTAIRGDRAVLAAKYANTKRKLPSTFNFGYVTADK antigen name:Polyprotein host organism:Gallus gallus antibody name:scFv2

    Publication: 22698877;

  4. Development of a novel immunoassay for the measurement of type II collagen neoepitope generated by collagenase cleavage.

    ID: 1952968

    Description: epitope description:GEPGDDGPS antigen name:Collagen alpha-1(II) chain host organism:Mus musculus A/J antibody name:6G4

    Publication: 22507082;

  5. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1952997

    Description: epitope description:GEPIRFLLSYGEKDF antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  6. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1952998

    Description: epitope description:FLLSYGEKDFEDYRF antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  7. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953005

    Description: epitope description:GEKDFEDYRFQEGDW antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  8. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953007

    Description: epitope description:EDYRFQEGDWPNLKP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  9. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953008

    Description: epitope description:EDYRFQEGDWPNLKP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  10. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953011

    Description: epitope description:QEGDWPNLKPSMPFG antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  11. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953018

    Description: epitope description:SMPFGKTPVLEIDGK antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  12. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953025

    Description: epitope description:KTPVLEIDGKQTHQS antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  13. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953026

    Description: epitope description:EIDGKQTHQSVAISR antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  14. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953027

    Description: epitope description:EIDGKQTHQSVAISR antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  15. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953028

    Description: epitope description:EIDGKQTHQSVAISR antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  16. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953030

    Description: epitope description:QTHQSVAISRYLGKQ antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  17. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953053

    Description: epitope description:NLEIDMIVDTISDFR antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  18. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953054

    Description: epitope description:MIVDTISDFRAAIAN antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  19. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953055

    Description: epitope description:MIVDTISDFRAAIAN antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  20. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953058

    Description: epitope description:ISDFRAAIANYHYDA antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  21. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953059

    Description: epitope description:ISDFRAAIANYHYDA antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  22. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953061

    Description: epitope description:ISDFRAAIANYHYDA antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  23. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953071

    Description: epitope description:DENSKQKKWDPLKKE antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  24. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953077

    Description: epitope description:QKKWDPLKKETIPYY antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  25. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953080

    Description: epitope description:PLKKETIPYYTKKFD antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  26. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953081

    Description: epitope description:PLKKETIPYYTKKFD antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  27. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953087

    Description: epitope description:TKKFDEVVKANGGYL antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  28. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953091

    Description: epitope description:EVVKANGGYLAAGKL antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  29. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953092

    Description: epitope description:EVVKANGGYLAAGKL antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  30. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953094

    Description: epitope description:NGGYLAAGKLTWADF antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  31. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953096

    Description: epitope description:NGGYLAAGKLTWADF antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  32. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953099

    Description: epitope description:AAGKLTWADFYFVAI antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  33. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953106

    Description: epitope description:LDYLNHMAKEDLVAN antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  34. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953107

    Description: epitope description:LDYLNHMAKEDLVAN antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  35. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953110

    Description: epitope description:HMAKEDLVANQPNLK antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  36. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953111

    Description: epitope description:HMAKEDLVANQPNLK antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  37. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953115

    Description: epitope description:DLVANQPNLKALREK antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  38. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953116

    Description: epitope description:DLVANQPNLKALREK antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  39. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953118

    Description: epitope description:QPNLKALREKVLGLP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  40. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953121

    Description: epitope description:QPNLKALREKVLGLP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  41. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953127

    Description: epitope description:VLGLPAIKAWVAKRP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  42. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953128

    Description: epitope description:VLGLPAIKAWVAKRP antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  43. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953131

    Description: epitope description:AIKAWVAKRPPTDL antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  44. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953133

    Description: epitope description:AIKAWVAKRPPTDL antigen name:Bla g 5 host organism:Homo sapiens

    Publication: 22541242;

  45. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953146

    Description: epitope description:EVDGQQLAQSQAICRYLAKT antigen name:Glutathione S-transferase 2 host organism:Homo sapiens

    Publication: 22541242;

  46. Molecular mimicry between cockroach and helminth glutathione S-transferases promotes cross-reactivity and cross-sensitization.

    ID: 1953150

    Description: epitope description:TDDRINASDWPSMKS antigen name:Other Wuchereria bancrofti (agent of lymphatic filariasis) protein host organism:Mus musculus BALB/c

    Publication: 22541242;

  47. Molecular basis of crossreactivity and the limits of antibody-antigen complementarity.

    ID: 1953171

    Description: epitope description:progesterone host organism:Mus musculus BALB/c antibody name:DB3

    Publication: 8413674;

  48. Ail protein binds ninth type III fibronectin repeat (9FNIII) within central 120-kDa region of fibronectin to facilitate cell binding by Yersinia pesti...

    ID: 1953219

    Description: epitope description:F282, S283, H293, T304 antigen name:Fibronectin (UniProt:P02751) host organism:Rattus norvegicus Sprague-Dawley antibody name:12B4...

    Publication: 22447929;

  49. Ail protein binds ninth type III fibronectin repeat (9FNIII) within central 120-kDa region of fibronectin to facilitate cell binding by Yersinia pesti...

    ID: 1953223

    Description: epitope description:D22, A23, T27, G60, L61, V65 antigen name:Fibronectin (UniProt:P02751) host organism:Rattus norvegicus Sprague-Dawley antibody nam...

    Publication: 22447929;

  50. A novel atherogenic epitope from Mycobacterium tuberculosis heat shock protein 65 enhances atherosclerosis in rabbit and LDL receptor-deficient mice.

    ID: 1953226

    Description: epitope description:NPLGLKRGIEKAVEK antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22038107;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston