Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. A novel atherogenic epitope from Mycobacterium tuberculosis heat shock protein 65 enhances atherosclerosis in rabbit and LDL receptor-deficient mice.

    ID: 1953227

    Description: epitope description:LSLLGKARKVVVTKD antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22038107;

  2. A novel atherogenic epitope from Mycobacterium tuberculosis heat shock protein 65 enhances atherosclerosis in rabbit and LDL receptor-deficient mice.

    ID: 1953231

    Description: epitope description:ATVLAQALVREGLRN antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22038107;

  3. A novel atherogenic epitope from Mycobacterium tuberculosis heat shock protein 65 enhances atherosclerosis in rabbit and LDL receptor-deficient mice.

    ID: 1953233

    Description: epitope description:ATVLAQALVREGLRN antigen name:60 kDa chaperonin 2 (UniProt:P9WPE7) host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22038107;

  4. Ail protein binds ninth type III fibronectin repeat (9FNIII) within central 120-kDa region of fibronectin to facilitate cell binding by Yersinia pesti...

    ID: 1953234

    Description: epitope description:D112, A113, T117, G150, L151, V155 antigen name:Fibronectin host organism:Rattus norvegicus Sprague-Dawley antibody name:16G3

    Publication: 22447929;

  5. Ail protein binds ninth type III fibronectin repeat (9FNIII) within central 120-kDa region of fibronectin to facilitate cell binding by Yersinia pesti...

    ID: 1953242

    Description: epitope description:A1551, S1598 antigen name:Cumulus cell-specific fibronectin 1 transcript variant host organism:Mus musculus antibody name:3E3

    Publication: 22447929;

  6. Protection against the toxic effects of Loxosceles intermedia spider venom elicited by mimotope peptides.

    ID: 1953347

    Description: epitope description:NSNKNDHLFASW host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21872636;

  7. Protection against the toxic effects of Loxosceles intermedia spider venom elicited by mimotope peptides.

    ID: 1953358

    Description: epitope description:NCNKNDHLFACW host organism:Oryctolagus cuniculus New Zealand White

    Publication: 21872636;

  8. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953427

    Description: epitope description:PQQQIPQQHPIPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  9. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953431

    Description: epitope description:PQQKVPHQEFPQH antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  10. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953463

    Description: epitope description:beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 11164910;

  11. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953468

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 11164910;

  12. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953474

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11164910;

  13. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953476

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Homo sapiens

    Publication: 11164910;

  14. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953477

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 11164910;

  15. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953491

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11164910;

  16. Guillain-Barré syndrome with IgM antibody to the ganglioside GalNAc-GD1a.

    ID: 1953493

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosylceramide host organism:Homo sapiens

    Publication: 11164910;

  17. Is Campylobacter lipopolysaccharide bearing a GD3 epitope essential for the pathogenesis of Guillain-Barré syndrome?

    ID: 1953510

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 10949532;

  18. Is Campylobacter lipopolysaccharide bearing a GD3 epitope essential for the pathogenesis of Guillain-Barré syndrome?

    ID: 1953513

    Description: epitope description:ganglioside GT1b host organism:Homo sapiens

    Publication: 10949532;

  19. Is Campylobacter lipopolysaccharide bearing a GD3 epitope essential for the pathogenesis of Guillain-Barré syndrome?

    ID: 1953519

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 10949532;

  20. Protection against enterovirus 71 with neutralizing epitope incorporation within adenovirus type 3 hexon.

    ID: 1953529

    Description: epitope description:YPTFGEHKQEKDLEY antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 22848478;

  21. Structure of an IgNAR-AMA1 complex: targeting a conserved hydrophobic cleft broadens malarial strain recognition.

    ID: 1953547

    Description: epitope description:T171, N173, Q174, P185, T186, E187, P188, M190, F201, Y202, K203, D204, N205, H220, G222, N223, I225, D227, N228, K230, N231 antig...

    Publication: 17997971;

  22. Structure of an IgNAR-AMA1 complex: targeting a conserved hydrophobic cleft broadens malarial strain recognition.

    ID: 1953548

    Description: epitope description:T171, N173, Q174, P185, T186, E187, P188, M190, F201, Y202, K203, D204, N205, H220, G222, N223, I225, D227, N228, K230, N231 antig...

    Publication: 17997971;

  23. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953577

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host organism:Homo sapiens

    Publication: 11854201;

  24. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953590

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11854201;

  25. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953596

    Description: epitope description:alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)-beta-Gal-(1->3)-beta-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-Gal-(1->...

    Publication: 11854201;

  26. Epitopes, avidity and IgG subclasses of tyrosine hydroxylase autoantibodies in vitiligo and alopecia areata patients.

    ID: 1953601

    Description: epitope description:MPTPDATTPQAKGF antigen name:Tyrosine 3-monooxygenase host organism:Homo sapiens

    Publication: 22329856;

  27. Epitopes, avidity and IgG subclasses of tyrosine hydroxylase autoantibodies in vitiligo and alopecia areata patients.

    ID: 1953606

    Description: epitope description:ARKEREAAVAAAAAAV antigen name:Tyrosine 3-monooxygenase host organism:Homo sapiens

    Publication: 22329856;

  28. Epitopes, avidity and IgG subclasses of tyrosine hydroxylase autoantibodies in vitiligo and alopecia areata patients.

    ID: 1953613

    Description: epitope description:MPTPDATTPQAKGF antigen name:Tyrosine 3-monooxygenase host organism:Homo sapiens

    Publication: 22329856;

  29. Epitopes, avidity and IgG subclasses of tyrosine hydroxylase autoantibodies in vitiligo and alopecia areata patients.

    ID: 1953615

    Description: epitope description:PSEPGDPLEAVAFEEKEGKA antigen name:Tyrosine 3-monooxygenase host organism:Homo sapiens

    Publication: 22329856;

  30. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953623

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11854201;

  31. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953625

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11854201;

  32. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953675

    Description: epitope description:QQQIPATQFPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  33. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953679

    Description: epitope description:FPQQQIAQQPQQL antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  34. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953683

    Description: epitope description:QFPQQQQFPQQQS antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  35. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953695

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11854201;

  36. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953717

    Description: epitope description:QQQQFPQQQQLTQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  37. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953722

    Description: epitope description:QQFPQQPPQQFPQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  38. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953728

    Description: epitope description:QQPSGSNVISISG antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  39. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953732

    Description: epitope description:QQFPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  40. Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis.

    ID: 1953735

    Description: epitope description:QQYPQQQ antigen name:Other Triticum aestivum (Canadian hard winter wheat) protein host organism:Homo sapiens

    Publication: 14699123;

  41. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953748

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-[alpha-N-acetylneuraminosyl-(2->3...

    Publication: 11854201;

  42. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953749

    Description: epitope description:beta-D-Gal-(1->3)-beta-D-GalNAc-(1->4)-[alpha-Neu5Ac-(2->8)-alpha-Neu5Ac-(2->3)]-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer host or...

    Publication: 11854201;

  43. Structure of Campylobacter jejuni lipopolysaccharides determines antiganglioside specificity and clinical features of Guillain-Barré and Miller...

    ID: 1953751

    Description: epitope description:alpha-N-acetylneuraminosyl-(2->8)-alpha-N-acetylneuraminosyl-(2->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl-(1<->1')-ceramide hos...

    Publication: 11854201;

  44. Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.

    ID: 1953755

    Description: epitope description:A: Q302, E303, G304, F305, V306, F307, E308, V311, Q313, T334, R336, V365, P366, Q367, Y368, D369, G370, S371, R373, Y375, Y378; B...

    Publication: 22039098;

  45. Identification and characterization of a monoclonal antibody recognizing the linear epitope RVADVI on VP1 protein of enterovirus 71.

    ID: 1953783

    Description: epitope description:RVADVI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D9

    Publication: 22930511;

  46. Identification and characterization of a monoclonal antibody recognizing the linear epitope RVADVI on VP1 protein of enterovirus 71.

    ID: 1953815

    Description: epitope description:RVADVI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D9

    Publication: 22930511;

  47. Identification and characterization of a monoclonal antibody recognizing the linear epitope RVADVI on VP1 protein of enterovirus 71.

    ID: 1953820

    Description: epitope description:RVADVI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D9

    Publication: 22930511;

  48. Identification and characterization of a monoclonal antibody recognizing the linear epitope RVADVI on VP1 protein of enterovirus 71.

    ID: 1953822

    Description: epitope description:RVADVI antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1D9

    Publication: 22930511;

  49. Passive immunization against pyroglutamate-3 amyloid-beta reduces plaque burden in Alzheimer-like transgenic mice: a pilot study.

    ID: 1953824

    Description: epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus APPsw antibody n...

    Publication: 22343072;

  50. Rabbit serum against K1 peptide, an immunogenic epitope of the Trypanosoma cruzi KMP-11, decreases parasite invasion to cells.

    ID: 1953827

    Description: epitope description:TLEEFSAKL antigen name:Other Trypanosoma cruzi protein host organism:Oryctolagus cuniculus New Zealand White

    Publication: 22687575;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston