Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511956

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  2. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511958

    Description: epitope description:RAVFMQQRPLRM antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  3. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511959

    Description: epitope description:VFMQQRPLRMFL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  4. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511967

    Description: epitope description:QQMSINVDNQFNYVP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  5. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513252

    Description: epitope description:ETDEEYYSVEKLIGQAEDVEHEYHK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  6. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513278

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  7. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513279

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  8. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513315

    Description: epitope description:ALNIWDRFDVFCTLGATTGYLKGNSPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  9. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513319

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  10. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513324

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston