Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 10 of 1,510,353 results for " "

  1. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1513671

    Description: epitope description:NIYQNCSKCNNS antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  2. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513705

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  3. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513706

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  4. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513707

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  5. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513710

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  6. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513711

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  7. Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.

    ID: 1513720

    Description: epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Mus musculus BALB/c antibody name:Anti-toxin A

    Publication: 8553561;

  8. Topology of the major capsid protein P3 of bacteriophage PRD1: analysis using monoclonal antibodies and C-terminally truncated proteins.

    ID: 1513722

    Description: epitope description:TGELTMYYWV antigen name:Major capsid protein P3 host organism:Mus musculus BALB/c antibody name:3N81, 3R2

    Publication: 7504366;

  9. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513736

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  10. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513737

    Description: epitope description:DVTLYGTIKAGV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;
Displaying 10 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston