Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Human and murine antibodies cross-reactive with streptococcal M protein and myosin recognize the sequence GLN-LYS-SER-LYS-GLN in M protein.

    ID: 1349512

    Description: epitope description:EQKSKQN antigen name:UniProt:A2RGM0 host organism:Homo sapiens antibody name:Anti-myosin Abs

    Publication: 2677144;

  2. Hepatitis B virus vaccine: identification of HBsAg/a and HBsAg/d but not HBsAg/y subtype antigenic determinants on a synthetic immunogenic peptide.

    ID: 1349524

    Description: epitope description:KPTDGN antigen name:Large envelope protein host organism:Mus musculus ICR X Swiss

    Publication: 6176997;

  3. Presentation of two epitopes of the preS2 region of hepatitis B virus on live recombinant bacteria.

    ID: 1349527

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:anti-LamB-preS2-A

    Publication: 2442253;

  4. Neonatal and maternal immunological responses to conserved epitopes within the DBL-gamma3 chondroitin sulfate A-binding domain of Plasmodium falciparu...

    ID: 1349535

    Description: epitope description:EAFIKTAAAETFLAW antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I220) host organism:Homo sapiens

    Publication: 16299291;

  5. Neonatal and maternal immunological responses to conserved epitopes within the DBL-gamma3 chondroitin sulfate A-binding domain of Plasmodium falciparu...

    ID: 1349538

    Description: epitope description:DICLGTDISVKQGDV antigen name:Erythrocyte membrane protein 1, PfEMP1 (UniProt:Q8I220) host organism:Homo sapiens

    Publication: 16299291;

  6. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349586

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Anti-HBsA...

    Publication: 3657796;

  7. Immunological cross-reactivity between preS2 sequences of the hepatitis B virus envelope proteins corresponding to serological subtypes adw2 and ayw.

    ID: 1349596

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus antibody name:Rabbit se...

    Publication: 3657796;

  8. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349616

    Description: epitope description:CTKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6181506;

  9. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349617

    Description: epitope description:CTKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  10. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349618

    Description: epitope description:TKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6181506;

  11. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349619

    Description: epitope description:TKPTDGNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  12. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349621

    Description: epitope description:GNCTCIPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  13. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349628

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  14. Expression in Escherichia coli of a cloned DNA sequence encoding the pre-S2 region of hepatitis B virus.

    ID: 1349630

    Description: epitope description:MQWNSTALHQALQDPRVRGLYLPAGG antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 2415963;

  15. Immune response to synthetic peptide analogues of hepatitis B surface antigen specific for the a determinant.

    ID: 1349632

    Description: epitope description:IPIPSSWAF antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6181506;

  16. Affinity of antibody responses in man to hepatitis B vaccine determined with synthetic peptides.

    ID: 1349638

    Description: epitope description:CTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 6146750;

  17. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349639

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C57BL/10

    Publication: 2425034;

  18. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349643

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus B10.BR

    Publication: 2425034;

  19. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349670

    Description: epitope description:HQTLQDPRVRG antigen name:Large envelope protein host organism:Mus musculus B10.M

    Publication: 2425034;

  20. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1349715

    Description: epitope description:MQWNSTTFHQTLQ antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston