Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 100 of 1,510,353 results for " "

  1. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511595

    Description: epitope description:GLMVWCIENGTSPNVNGV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  2. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511597

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  3. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511603

    Description: epitope description:GLMVWCIENGTSPNVNGV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  4. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511610

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  5. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511615

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  6. Autoantibodies to the HLA-B27 sequence cross-react with the hypothetical peptide from the arthritis-associated Shigella plasmid.

    ID: 1511882

    Description: epitope description:AKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Homo sapiens antibody name:an...

    Publication: 2212008;

  7. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511902

    Description: epitope description:DNLAPMSDGAVQPDG antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  8. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511907

    Description: epitope description:QPDGGQPAVRNERAT antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  9. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511911

    Description: epitope description:GQPAVRNERATGSGN antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  10. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511617

    Description: epitope description:NKGKDKDVNAGTSGTHT antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  11. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511623

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  12. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511624

    Description: epitope description:TQEENTERHTTEDVSPS antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  13. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511628

    Description: epitope description:NGVWVMMDGNEQVEYPLK antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  14. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511629

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  15. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511634

    Description: epitope description:APQQIDISNTRATQSQFD antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  16. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511646

    Description: epitope description:DGEEQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  17. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511647

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  18. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511659

    Description: epitope description:EQVEYPLKPI antigen name:polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  19. Detection of potyviruses with antisera to synthetic peptides.

    ID: 1511668

    Description: epitope description:FDFYEVTSRTPVRAREA antigen name:Genome polyprotein host organism:Oryctolagus cuniculus

    Publication: 1381514;

  20. Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.

    ID: 1511684

    Description: epitope description:L237, G238, G239, K257, A260, K261, T264, W269, S270, G271, E272, K273, Y276, N279, G283, W284, G285, G308, G309, S310, S311, G413...

    Publication: 11960990;

  21. Three camelid VHH domains in complex with porcine pancreatic alpha-amylase. Inhibition and versatility of binding topology.

    ID: 1511686

    Description: epitope description:Y2, P154, Y155, W203, P204, G205, D206, K208, K243, S245, E246, F248, G249, E282, G285, P288, R291 antigen name:Pancreatic alpha-a...

    Publication: 11960990;

  22. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511751

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  23. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511753

    Description: epitope description:D385, A392, S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-12H

    Publication: 1701477;

  24. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511758

    Description: epitope description:A392 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-10C

    Publication: 1701477;

  25. Identification of operationally overlapping and independent cross-reactive neutralization regions on human rotavirus VP4.

    ID: 1511764

    Description: epitope description:S428, E433 antigen name:Outer capsid protein VP4 host organism:Mus musculus BALB/c antibody name:KU-2A, KU-7E, KU10H

    Publication: 1701477;

  26. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511769

    Description: epitope description:AATTVNGGTVHFK antigen name:Type-1 fimbrial protein, A chain host organism:Oryctolagus cuniculus

    Publication: 9276729;

  27. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511776

    Description: epitope description:CKTANGTAIPIGGGSANVYVNLAPV antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  28. Localization of a domain in the FimH adhesin of Escherichia coli type 1 fimbriae capable of receptor recognition and use of a domain-specific antibody...

    ID: 1511781

    Description: epitope description:NYARTGGQVTAG antigen name:Protein FimH host organism:Mus musculus ICR

    Publication: 9276729;

  29. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1511784

    Description: epitope description:DLKCSLPHRNESNKWTCAARRKGSRRDSLYIAGRDFWGR antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  30. Autoantibodies to the HLA-B27 sequence cross-react with the hypothetical peptide from the arthritis-associated Shigella plasmid.

    ID: 1511797

    Description: epitope description:AKAQTDREDLRTLLRY antigen name:HLA class I histocompatibility antigen, B-27 alpha chain host organism:Oryctolagus cuniculus antibod...

    Publication: 2212008;

  31. Inhibition of cell adhesion to the virus by synthetic peptides of fiber knob of human adenovirus serotypes 2 and 3 and virus neutralisation by anti-pe...

    ID: 1511840

    Description: epitope description:GKYTTETFATNSYTFSYIAQE antigen name:Fiber protein host organism:Oryctolagus cuniculus

    Publication: 8896246;

  32. VEGF and the Fab fragment of a humanized neutralizing antibody: crystal structure of the complex at 2.4 A resolution and mutational analysis of the in...

    ID: 1511861

    Description: epitope description:V: F43, Y47; W: Y71, K74, Q105, I106, M107, R108, I109, K110, H112, Q113, G114, Q115, H116, I117, G118, E119, M120 antigen name:Va...

    Publication: 9753694;

  33. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511930

    Description: epitope description:AVNGNMALDDIHAQI antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  34. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511938

    Description: epitope description:AAASSPDAHVPF antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  35. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511940

    Description: epitope description:SPDAHVPFCFGK antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  36. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511942

    Description: epitope description:HVPFCFGKDLKR antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  37. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511944

    Description: epitope description:CFGKDLKRPGSS antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  38. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511947

    Description: epitope description:KRPGSSPMEVML antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  39. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511951

    Description: epitope description:MLRAVFMQQRPL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus C57BL/6

    Publication: 7684728;

  40. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511955

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  41. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511956

    Description: epitope description:RALGLPPFLNSLPQS antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  42. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511958

    Description: epitope description:RAVFMQQRPLRM antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  43. Identification of B-cell epitopes on the S4 subunit of pertussis toxin.

    ID: 1511959

    Description: epitope description:VFMQQRPLRMFL antigen name:Pertussis toxin subunit 4 host organism:Mus musculus CF-1

    Publication: 7684728;

  44. Effective induction of neutralizing antibodies with the amino terminus of VP2 of canine parvovirus as a synthetic peptide.

    ID: 1511967

    Description: epitope description:QQMSINVDNQFNYVP antigen name:Capsid protein VP1 host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7887026;

  45. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513252

    Description: epitope description:ETDEEYYSVEKLIGQAEDVEHEYHK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  46. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513278

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  47. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513279

    Description: epitope description:KPQEEKEKITKEILNGK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  48. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513315

    Description: epitope description:ALNIWDRFDVFCTLGATTGYLKGNSPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  49. IgG subclass-associated differences in anti-schistosomal antibody specificity.

    ID: 1513319

    Description: epitope description:LADLVLIAVIDHVTDLDK antigen name:Glutathione S-transferase class-mu 28 kDa isozyme host organism:Homo sapiens

    Publication: 7997850;

  50. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513324

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  51. Characterization of intertype specific epitopes on adenovirus hexons.

    ID: 1513329

    Description: epitope description:NQAVDSYDPD antigen name:Hexon protein host organism:Mus musculus BALB/c

    Publication: 9787653;

  52. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513333

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  53. Identification and characterization of T helper cell epitopes of the major outer membrane protein of Chlamydia trachomatis.

    ID: 1513334

    Description: epitope description:KMKSRKSCGIAVGTTWDADKYAVTPTTSDVAGLEKDPVA host organism:Mus musculus A/J

    Publication: 1694217;

  54. Evaluation of mutagenesis for epitope mapping. Structure of an antibody-protein antigen complex.

    ID: 1513458

    Description: epitope description:M1, F2, Q3, Q4, T34, S41, S64, E66, G67, E68, E70, Q71, K72, E75 antigen name:Phosphocarrier protein HPr host organism:Mus musculu...

    Publication: 7684366;

  55. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513483

    Description: epitope description:VDELD antigen name:Basic phospholipase A2 pseudexin B chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  56. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513486

    Description: epitope description:YGCYCGLGG antigen name:Phospholipase A2, major isoenzyme host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  57. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513487

    Description: epitope description:YGCYCGAGG antigen name:Basic phospholipase A2 notechis 11'2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  58. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513491

    Description: epitope description:FPKMSAYDY antigen name:Scutoxin host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  59. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513496

    Description: epitope description:NTKWDIYRY antigen name:Phospholipase A2 crotoxin basic chain CBa2 host organism:Mus musculus BALB/c antibody name:Mab 14

    Publication: 1718309;

  60. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513499

    Description: epitope description:IDDLD antigen name:Acidic phospholipase A2 homolog taipoxin gamma chain host organism:Mus musculus BALB/c antibody name:Mab 2

    Publication: 1718309;

  61. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513500

    Description: epitope description:YGCYCGKGG antigen name:Basic phospholipase A2 taipoxin alpha chain host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  62. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513501

    Description: epitope description:TPYTSLYTW antigen name:Vipera aspis (aspic viper) protein host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  63. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513506

    Description: epitope description:YGCYCGWGG antigen name:Phospholipase A2 crotoxin basic chain CBa2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  64. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513509

    Description: epitope description:YGCYCGRGG antigen name:Acidic phospholipase A2 2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  65. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513510

    Description: epitope description:YGCYCGVGG antigen name:Basic phospholipase A2 ammodytoxin B host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  66. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513513

    Description: epitope description:NTKWDIYGY antigen name:Vipera aspis (aspic viper) protein host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  67. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513533

    Description: epitope description:YGCYCGAGG antigen name:Basic phospholipase A2 notechis 11'2 host organism:Mus musculus BALB/c antibody name:mAb 14

    Publication: 1718309;

  68. Epitope mapping of snake venom phospholipases A2 with pseudexin monoclonal antibodies.

    ID: 1513535

    Description: epitope description:IDDLD antigen name:Acidic phospholipase A2 homolog taipoxin gamma chain host organism:Mus musculus BALB/c antibody name:mAb 2

    Publication: 1718309;

  69. Immunogenicity of poliovirus B and T cell epitopes presented by hybrid porcine parvovirus particles.

    ID: 1513613

    Description: epitope description:DNPASTTNKDK antigen name:Genome polyprotein host organism:Mus musculus BALB/c

    Publication: 7561778;

  70. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1513669

    Description: epitope description:WNIYQNCSKCNN antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  71. Naturally occurring mutations within 39 amino acids in the envelope glycoprotein of maedi-visna virus alter the neutralization phenotype.

    ID: 1513671

    Description: epitope description:NIYQNCSKCNNS antigen name:envelope polyprotein host organism:Ovis aries

    Publication: 10482555;

  72. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513705

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  73. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513706

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  74. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513707

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  75. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513710

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  76. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513711

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  77. Synthesis of bluetongue virus chimeric VP3 molecules and their interactions with VP7 protein to assemble into virus core-like particles.

    ID: 1513720

    Description: epitope description:ATGWQTIDGKKYYFNTNTAEAATGWQTIDGKKYYFNTNTAIAST antigen name:Toxin A host organism:Mus musculus BALB/c antibody name:Anti-toxin A

    Publication: 8553561;

  78. Topology of the major capsid protein P3 of bacteriophage PRD1: analysis using monoclonal antibodies and C-terminally truncated proteins.

    ID: 1513722

    Description: epitope description:TGELTMYYWV antigen name:Major capsid protein P3 host organism:Mus musculus BALB/c antibody name:3N81, 3R2

    Publication: 7504366;

  79. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513736

    Description: epitope description:FGKLRVGRLNSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  80. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513737

    Description: epitope description:DVTLYGTIKAGV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  81. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513738

    Description: epitope description:TIKAGVETSRSV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  82. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513743

    Description: epitope description:FKGQEDLGNGLK antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  83. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513745

    Description: epitope description:AIWQVEQKASIA antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  84. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513747

    Description: epitope description:GTDSGWGNRQSF antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  85. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513749

    Description: epitope description:IGLKGGFGKLRV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  86. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513763

    Description: epitope description:FFVQYGGAYKRH antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  87. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513771

    Description: epitope description:AKLTDASNSHNS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  88. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513779

    Description: epitope description:EYDQVVVGAEYD antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  89. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513796

    Description: epitope description:IGLKGGFGKLRV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  90. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513798

    Description: epitope description:INPWDSKSDYLG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  91. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513803

    Description: epitope description:SGSVQYALNDNA antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  92. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513805

    Description: epitope description:GRHNSESYHAGF antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  93. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513809

    Description: epitope description:GAYKRHHQVQEG antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  94. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513810

    Description: epitope description:LNIEKYQIHRLV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  95. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513819

    Description: epitope description:VGAEYDFSKRTS antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  96. Immune responses to linear epitopes on the PorB protein of Neisseria meningitidis in patients with systemic meningococcal disease.

    ID: 1513822

    Description: epitope description:WLQEGKGENKFV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 8828216;

  97. Mapping of an epitope recognized by a neutralizing monoclonal antibody specific to toxin Cn2 from the scorpion Centruroides noxius, using discontinuou...

    ID: 1513833

    Description: epitope description:L21, V22, D23, K24, N25, T26, G27, C28, K29, Y30, A71, I72, V73, W74, P75, L76, P77, N78, K79, R80,C81, S82 antigen name:Beta-mamm...

    Publication: 10491120;

  98. Analysis of the putative E1 envelope and NS4a epitope regions of HCV type 3.

    ID: 1513910

    Description: epitope description:SQAAPYIEQAQVIAHQFKEK antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7683463;

  99. A linear B-cell epitope on the class 3 outer-membrane protein of Neisseria meningitidis recognized after vaccination with the Norwegian group B outer-...

    ID: 1513912

    Description: epitope description:DVTLYGTIKAGV antigen name:Major outer membrane protein P.IB host organism:Homo sapiens

    Publication: 7551027;

  100. Analysis of the putative E1 envelope and NS4a epitope regions of HCV type 3.

    ID: 1513913

    Description: epitope description:LSGKPAIIPDREVLYREFDE antigen name:Genome polyprotein host organism:Homo sapiens

    Publication: 7683463;
Displaying 100 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston