Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Nonoverlapping T and B cell determinants on an hepatitis B surface antigen pre-S(2) region synthetic peptide.

    ID: 1350039

    Description: epitope description:MQWNSTTFHQTLQDPRVRGLYFPAGG antigen name:Large envelope protein host organism:Mus musculus C3H.Q

    Publication: 2425034;

  2. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350067

    Description: epitope description:MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  3. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350084

    Description: epitope description:NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  4. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350087

    Description: epitope description:NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  5. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350100

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  6. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350104

    Description: epitope description:PLGFFPDHQLDPAFGANSNNPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  7. Identification and characterization of a C(K/R)TC motif as a common epitope present in all subtypes of hepatitis B surface antigen.

    ID: 1350108

    Description: epitope description:CKTC antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:H166

    Publication: 8617960;

  8. Antibodies to synthetic peptides from the pre-S1 and pre-S2 regions of one subtype of the hepatitis B virus (HBV) envelope protein recognize all HBV s...

    ID: 1350111

    Description: epitope description:PLGFFPDHQLDPAFRANTANPDWDFNP antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 3657811;

  9. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350129

    Description: epitope description:KENCGA antigen name:Merozoite surface antigen 2 host organism:Mus musculus

    Publication: 10792760;

  10. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350130

    Description: epitope description:TSLLSNS antigen name:Other Plasmodium falciparum (malaria parasite P. falciparum) protein host organism:Mus musculus

    Publication: 10792760;

  11. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350138

    Description: epitope description:TTTTTKTTTTT antigen name:Merozoite surface antigen 2 host organism:Mus musculus Quackenbush

    Publication: 10792760;

  12. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350139

    Description: epitope description:KNAETNPKGKGEVQ antigen name:Merozoite surface antigen 2 host organism:Homo sapiens

    Publication: 10792760;

  13. Recombinant chimeric proteins generated from conserved regions of Plasmodium falciparum merozoite surface protein 2 generate antiparasite humoral resp...

    ID: 1350140

    Description: epitope description:KNAETNPKGKGEVQ antigen name:Merozoite surface antigen 2 host organism:Mus musculus Quackenbush

    Publication: 10792760;

  14. A novel microencapsulated peptide vaccine against hepatitis B.

    ID: 1350267

    Description: epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Mus musculus BALB/c

    Publication: 11312028;

  15. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350293

    Description: epitope description:CLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  16. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350318

    Description: epitope description:LTRILTIPQSLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  17. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350323

    Description: epitope description:SLDSW antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  18. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350333

    Description: epitope description:FLPLLPIFFCLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  19. Chemically synthesized peptides predicted from the nucleotide sequence of the hepatitis B virus genome elicit antibodies reactive with the native enve...

    ID: 1350336

    Description: epitope description:CLWVYI antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 6167985;

  20. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350393

    Description: epitope description:PAFGANSNNPDWDFNPVKDDWP antigen name:Large envelope protein host organism:Mus musculus

    Publication: 2423607;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston