Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 20 of 1,510,353 results for " "

  1. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350399

    Description: epitope description:MGTNLSVPNPLGFFPDHQLDP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2423607;

  2. Immune response to the pre-S(1) region of the hepatitis B surface antigen (HBsAg): a pre-S(1)-specific T cell response can bypass nonresponsiveness to...

    ID: 1350400

    Description: epitope description:PAFGANSNNPDWDFNPVKDDWP antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 2423607;

  3. Localization of hepatitis B surface antigen epitopes present on variants and specifically recognised by anti-hepatitis B surface antigen monoclonal an...

    ID: 1350406

    Description: epitope description:DYQGMLPVCP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:6H6B6

    Publication: 11536229;

  4. Localization of hepatitis B surface antigen epitopes present on variants and specifically recognised by anti-hepatitis B surface antigen monoclonal an...

    ID: 1350407

    Description: epitope description:DYQGMLPVCP antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:6H6B6

    Publication: 11536229;

  5. Distinction between immunogenicity and tolerogenicity among HBcAg T cell determinants. Influence of peptide-MHC interaction.

    ID: 1350544

    Description: epitope description:VSFGVWIRTPPAYRPPNAPIL antigen name:Capsid protein host organism:Mus musculus B10.S antibody name:Mouse sera

    Publication: 2478619;

  6. Distinction between immunogenicity and tolerogenicity among HBcAg T cell determinants. Influence of peptide-MHC interaction.

    ID: 1350545

    Description: epitope description:VSFGVWIRTPPAYRPPNAPIL antigen name:Capsid protein host organism:Mus musculus B10.S antibody name:Mouse sera

    Publication: 2478619;

  7. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350569

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Equus caballus

    Publication: 1376348;

  8. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350571

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Homo sapiens

    Publication: 1376348;

  9. A synthetic peptide spontaneously self-assembles to reconstruct a group-specific, conformational determinant of hepatitis B surface antigen.

    ID: 1350640

    Description: epitope description:CTTPAQGNSMFPSCCCTKPTDGNC antigen name:Large envelope protein host organism:Oryctolagus cuniculus

    Publication: 1376348;

  10. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350668

    Description: epitope description:VTCDTPPTY host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;

  11. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350671

    Description: epitope description:RTCAHPGEH host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;

  12. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350679

    Description: epitope description:GPFFLSPTS host organism:Oryctolagus cuniculus New Zealand White

    Publication: 7534789;

  13. Derivation of vaccines from mimotopes. Immunologic properties of human hepatitis B virus surface antigen mimotopes displayed on filamentous phage.

    ID: 1350682

    Description: epitope description:GPFYTSAPQ host organism:Mus musculus

    Publication: 7534789;

  14. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350695

    Description: epitope description:EQFAKTCPMQAVKGGWASTLCRSVYSGNVR host organism:Mus musculus antibody name:H5

    Publication: 8700874;

  15. Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library.

    ID: 1350697

    Description: epitope description:LTEVVISRSADCRFRDVITGECCGWHRGCF host organism:Mus musculus antibody name:H5

    Publication: 8700874;

  16. Immunogenicity of synthetic peptides derived from Plasmodium falciparum proteins.

    ID: 1345604

    Description: epitope description:DKNEKGQHEIVEVEEILPEDKNEKGQHEIVEVEEILPE host organism:Oryctolagus cuniculus New Zealand White

    Publication: 16513113;

  17. Merozoite surface protein-3: a malaria protein inducing antibodies that promote Plasmodium falciparum killing by cooperation with blood monocytes.

    ID: 1345617

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Mus musculus

    Publication: 8068948;

  18. Merozoite surface protein-3: a malaria protein inducing antibodies that promote Plasmodium falciparum killing by cooperation with blood monocytes.

    ID: 1345618

    Description: epitope description:AKEASSYDYILGWEFGGGVPEHKKEEN antigen name:Merozoite surface protein 3 host organism:Homo sapiens

    Publication: 8068948;

  19. Serum antibodies from malaria-exposed people recognize conserved epitopes formed by the two epidermal growth factor motifs of MSP1(19), the carboxy-te...

    ID: 1345659

    Description: epitope description:NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPT antigen name:Merozoite surface protein 1 host organism:Homo sapiens

    Publication: 7822010;

  20. Definition of T cell epitopes within the 19 kDa carboxylterminal fragment of Plasmodium yoelii merozoite surface protein 1 (MSP1(19)) and their role i...

    ID: 1345662

    Description: epitope description:LLGYKKGEGNTCVENNNPTC antigen name:Merozoite surface protein 1 host organism:Mus musculus C57BL/6

    Publication: 9651928;
Displaying 20 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston