Immunological Data Discovery Index
Advanced Search

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Displaying 50 of 1,510,353 results for " "

  1. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1966253

    Description: epitope description:ISLANYTG antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  2. An immune response directed to proteinase and adhesin functional epitopes protects against Porphyromonas gingivalis-induced periodontal bone loss.

    ID: 1966258

    Description: epitope description:YTGHGSET antigen name:Arginine-specific cysteine proteinase RgpA host organism:Mus musculus BALB/c

    Publication: 16148146;

  3. Structure of hepatitis C virus envelope glycoprotein E2 antigenic site 412 to 423 in complex with antibody AP33.

    ID: 1966260

    Description: epitope description:QLINTNGSWHIN antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:AP33

    Publication: 22973046;

  4. Identification of a conserved linear B-cell epitope in the M protein of porcine epidemic diarrhea virus.

    ID: 1966267

    Description: epitope description:WAFYVR antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 23025700;

  5. Identification of a conserved linear B-cell epitope in the M protein of porcine epidemic diarrhea virus.

    ID: 1966269

    Description: epitope description:WAFYVR antigen name:Membrane protein host organism:Mus musculus BALB/c antibody name:4D4

    Publication: 23025700;

  6. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1966273

    Description: epitope description:DAEFR antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 23217740;

  7. A plaque-specific antibody clears existing beta-amyloid plaques in Alzheimer's disease mice.

    ID: 1966283

    Description: epitope description:EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA + PYRE(E1) antigen name:Amyloid beta A4 protein host organism:Mus musculus

    Publication: 23217740;

  8. The structure of a polyQ-anti-polyQ complex reveals binding according to a linear lattice model.

    ID: 1966326

    Description: epitope description:GQQQQQQQQQQG host organism:Mus musculus BALB/c antibody name:MW1

    Publication: 17450152;

  9. Investigating the impact of hepatitis B virus surface gene polymorphism on antigenicity using ex vivo phenotyping.

    ID: 1966328

    Description: epitope description:CRTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:P2D3

    Publication: 22855781;

  10. Investigating the impact of hepatitis B virus surface gene polymorphism on antigenicity using ex vivo phenotyping.

    ID: 1966331

    Description: epitope description:CRTCTTPAQ antigen name:Large envelope protein host organism:Mus musculus BALB/c antibody name:P2D3

    Publication: 22855781;

  11. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966338

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  12. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966339

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  13. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966341

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  14. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966343

    Description: epitope description:W101, L107, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb 4.8A

    Publication: 23077306;

  15. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966358

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  16. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966359

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  17. Mechanistic study of broadly neutralizing human monoclonal antibodies against dengue virus that target the fusion loop.

    ID: 1966362

    Description: epitope description:W101, G109 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:mAb D11C, mAb 1.6D

    Publication: 23077306;

  18. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966368

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  19. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966373

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  20. Broad and potent neutralization of HIV-1 by a gp41-specific human antibody.

    ID: 1966383

    Description: epitope description:NEQELLELDKWASLWNWFDITNWLWYIR antigen name:Envelope glycoprotein gp160 host organism:Homo sapiens antibody name:10E8

    Publication: 23151583;

  21. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960425

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  22. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960426

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  23. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960429

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  24. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960433

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  25. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1960436

    Description: epitope description:QLYKTCKQAGTCPPDIIPKV antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;

  26. Epitope spreading of the anti-CYP2D6 antibody response in patients with autoimmune hepatitis and in the CYP2D6 mouse model.

    ID: 1960441

    Description: epitope description:QRFGDI antigen name:Cytochrome P450 2D6 host organism:Mus musculus FVB

    Publication: 21795021;

  27. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960456

    Description: epitope description:DVCEYYDPDYLNT antigen name:Botulinum neurotoxin type B host organism:Oryctolagus cuniculus

    Publication: 22922018;

  28. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960457

    Description: epitope description:GSSAYYDPNYLTT antigen name:UniProt:D5VV58 host organism:Oryctolagus cuniculus

    Publication: 22922018;

  29. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960461

    Description: epitope description:GSSAYYDPNYLTT antigen name:UniProt:D5VV58 host organism:Oryctolagus cuniculus

    Publication: 22922018;

  30. Epitope mapping of botulinum neurotoxins light chains.

    ID: 1960462

    Description: epitope description:DVCEYYDPDYLNT antigen name:Botulinum neurotoxin type B host organism:Oryctolagus cuniculus

    Publication: 22922018;

  31. Immunogenetic mechanisms driving norovirus GII.4 antigenic variation.

    ID: 1960659

    Description: epitope description:A294, R297, N298, S368, E372 antigen name:Capsid protein VP1 host organism:Homo sapiens antibody name:NVB111, NVB43.9

    Publication: 22615565;

  32. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960664

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  33. Increased immunogenicity and protective efficacy of influenza M2e fused to a tetramerizing protein.

    ID: 1960666

    Description: epitope description:SLLTEVETPTRSEWECRCSDSSD antigen name:Matrix protein 2 host organism:Mus musculus BALB/c

    Publication: 23049700;

  34. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960685

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  35. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960690

    Description: epitope description:G436, W437, L438, G440, L441, F442, Y443 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e509

    Publication: 22898087;

  36. Anti-hepatitis C virus E2 (HCV/E2) glycoprotein monoclonal antibodies and neutralization interference.

    ID: 1960708

    Description: epitope description:W437, L438, L441, F442 antigen name:Genome polyprotein host organism:Homo sapiens antibody name:e137

    Publication: 22898087;

  37. Isolation and structural characteristics of a monoclonal antibody-defined cross-reactive phospholipid antigen from Mycobacterium tuberculosis and Myco...

    ID: 1960753

    Description: epitope description:PIM2 host organism:Homo sapiens

    Publication: 1702433;

  38. Prevention of passively transferred experimental autoimmune myasthenia gravis by a phage library-derived cyclic peptide.

    ID: 1960818

    Description: epitope description:CAEPMTLPENYFSERPYHPPPPC host organism:Rattus norvegicus Lewis antibody name:198

    Publication: 10639153;

  39. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960845

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  40. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960846

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  41. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960847

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  42. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960853

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  43. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960859

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  44. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960862

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  45. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960865

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  46. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960868

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  47. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960869

    Description: epitope description:V300, M301, K334, P336, F337, S338, T339, Q340, E342, K343, G344, A345, T346, Q347, G349, R350, L351, P372, V379, A382, G383, E384...

    Publication: 23055922;

  48. Structural basis of differential neutralization of DENV-1 genotypes by an antibody that recognizes a cryptic epitope.

    ID: 1960873

    Description: epitope description:V580, M581, K614, P616, F617, S618, S619, Q620, E622, K623, G624, V625, T626, Q627, G629, R630, L631, P652, V659, A662, G663, E664...

    Publication: 23055922;

  49. Novel epitopes identified by anti-PrP monoclonal antibodies produced following immunization of Prnp0/0 Balb/cJ mice with purified scrapie prions.

    ID: 1960878

    Description: epitope description:N170, Q171, V172, Y173, Y174, R175, P176, V177, D178, Q179, Y180, S181, N185, F186, V187, H188, D189, C190, E222, Q223, M224, C225...

    Publication: 23098297;

  50. Development of AAVLP(HPV16/31L2) particles as broadly protective HPV vaccine candidate.

    ID: 1961045

    Description: epitope description:QLYQTCKAAGTCPSDVIPKI antigen name:Minor capsid protein L2 host organism:Oryctolagus cuniculus

    Publication: 22761884;
Displaying 50 of 1,510,353 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston